DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and CYP26B1

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_063938.1 Gene:CYP26B1 / 56603 HGNCID:20581 Length:512 Species:Homo sapiens


Alignment Length:528 Identity:120/528 - (22%)
Similarity:218/528 - (41%) Gaps:98/528 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVGVLLLVAFATLLLWDFLW--RRRGNGILPGPR---PLPFLGN----LLMYRGLDPEQIMDFVK 59
            :|.|.||:| .:..||...|  .|..:..||.|:   ..|.:|.    ||...|        |..
Human    19 LVSVTLLLA-VSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSG--------FQS 74

  Fly    60 KNQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLM-STGRKWH 123
            ..:.|||.:::..:|.:..:..|...::..:|..:.|:......:.....||...:. |.|....
Human    75 SRREKYGNVFKTHLLGRPLIRVTGAENVRKILMGEHHLVSTEWPRSTRMLLGPNTVSNSIGDIHR 139

  Fly   124 GRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIAETAMGTK 188
            .:||:.:..|..:.||.::   .:...|:.:.|::.:.....||::.                  
Human   140 NKRKVFSKIFSHEALESYL---PKIQLVIQDTLRAWSSHPEAINVYQ------------------ 183

  Fly   189 INAQKNPNLPYVQAVNDVTNILIK-----RFIHAWQR-VDWIFRLTQPTEA-----KRQDKAIKV 242
             .|||   |.:..|:..:....|.     .....:|: ||.:|.|  |.:.     :|..:|.::
Human   184 -EAQK---LTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSL--PVDLPFSGYRRGIQARQI 242

  Fly   243 MHDFTENIIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTID-GAPLSDEDIREEVD 306
            :....|..|||:.:....                |..:..||:|::|:.: |..::.:::::...
Human   243 LQKGLEKAIREKLQCTQG----------------KDYLDALDLLIESSKEHGKEMTMQELKDGTL 291

  Fly   307 TFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIR--DVL---GEDRKSPVTLRDLGELKFMEN 366
            ..:|..:.||.||.:..:.::.:||.|.::|:.|:|  .:|   |...:..:.|..|..|::::.
Human   292 ELIFAAYATTASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSGLRYLDC 356

  Fly   367 VIKESLRLHPPVPMIGRWFAEDVEIRGKHIPAG---------TNFTMGIFVLLRDPEYFESPDEF 422
            ||||.:||..|:....|...:..|:.|..||.|         |:.|..:|   :|...|: ||.|
Human   357 VIKEVMRLFTPISGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVF---KDVNVFD-PDRF 417

  Fly   423 RPERFDADVPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKL--LRHFELLPLGPEPRHSMNI 485
            ...|.:....:.|   |:||..|.|.|:|:..|.|.:|....:|  ...|| |.....||.::..
Human   418 SQARSEDKDGRFH---YLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFE-LATRTFPRITLVP 478

  Fly   486 VLRSANGV 493
            ||...:|:
Human   479 VLHPVDGL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 110/498 (22%)
CYP26B1NP_063938.1 p450 23..490 CDD:325183 118/524 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.