DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and cyp4f2

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001016020.1 Gene:cyp4f2 / 548774 XenbaseID:XB-GENE-6258041 Length:528 Species:Xenopus tropicalis


Alignment Length:470 Identity:163/470 - (34%)
Similarity:269/470 - (57%) Gaps:19/470 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PRPLPFLGNLLMYRGLDPEQIMDFVKKNQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHIT 98
            ||....||:|.|:  :..|:.:..:........|....|:.....|....|..::.|:::...|.
 Frog    63 PRRSWLLGHLGMF--MPTEEGLTEISSAICNLRRTLLTWLGPIPEVSLVHPDTVKPVVAASAAIA 125

  Fly    99 -KNNL-YKLLNCWLGDGLLMSTGRKWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQS-RA 160
             |:.| |..|..|||||||:|.|.||...|:::||.|||.||:.:|:||:|.:.:|:.:.:. .|
 Frog   126 PKDELFYGFLRPWLGDGLLLSRGEKWGQHRRLLTPAFHFDILKNYVKIFNQSTDIMLAKWRRLTA 190

  Fly   161 DGMTPINIFPVICLTALDIIAETAMGTKINAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDWIF 225
            :|...:::|..:.|..||.:.:.......:.|:.|: .|:.|:.:::::::||..:.....|:|:
 Frog   191 EGPVSLDMFEHVSLMTLDTLLKCTFSYDSDCQEKPS-DYISAIYELSSLVVKREHYLPHHFDFIY 254

  Fly   226 RLTQPTEAKRQDKAIKVMHDFTENIIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQS- 289
            .|:......||  |.|.:|:||..::::|::.|.....|...:.:     |.:....:|:||.| 
 Frog   255 NLSSNGRKFRQ--ACKTVHEFTAGVVQQRKKALQEKGMEEWIKSK-----QGKTKDFIDILLLSK 312

  Fly   290 TIDGAPLSDEDIREEVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVL-GEDRKSPV 353
            ..||:.|||||:|.|||||||||||||.|.:|:.||.::.|||.|::.::||.::| |:|.|. :
 Frog   313 NEDGSQLSDEDMRAEVDTFMFEGHDTTASGLSWILYNLACHPEYQEKCRKEITELLEGKDIKH-L 376

  Fly   354 TLRDLGELKFMENVIKESLRLHPPVPMIGRWFAEDVEI-RGKHIPAGTNFTMGIFVLLRDPEYFE 417
            ...:|.:|.|....|||||||||||..:.|...||::: :|..:|.|....:.||.:..:|:.:.
 Frog   377 EWDELSKLPFTTMCIKESLRLHPPVVAVIRRCTEDIKLPKGDILPKGNCCIINIFGIHHNPDVWP 441

  Fly   418 SPDEFRPERFDAD-VPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFEL-LPLGPEPR 480
            :|..:.|.|||.: :.:...||::||||||||||||.|||.|||..::.:|.:|:: |......|
 Frog   442 NPQVYDPYRFDPENLQERSSYAFVPFSAGPRNCIGQNFAMAEMKIVLALILYNFQVRLDETKTVR 506

  Fly   481 HSMNIVLRSANGVHL 495
            ....::||:.||:.|
 Frog   507 RKPELILRAENGLWL 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 162/468 (35%)
cyp4f2NP_001016020.1 p450 60..513 CDD:278495 158/460 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.