DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:571 Identity:122/571 - (21%)
Similarity:234/571 - (40%) Gaps:158/571 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLGVVGVLLLVAFATLLLWDFLWRRRGNGILPGPRPLPFLGNLLMYRGLDPEQIMDFVKKNQRKY 65
            :|.:||.||:...:|:..|..|      || |...|...:|::                |..|..
  Fly    11 LLALVGYLLMKWRSTMRHWQDL------GI-PCEEPHILMGSM----------------KGVRTA 52

  Fly    66 GRLYRVWILHQLAVFSTDP--------RDIEFVLSSQQHITKNNLYKLLNCWLGDG--------- 113
            .....:|..:......:.|        |...|||.:.  :.|..|.|..|.:...|         
  Fly    53 RSFNEIWTSYYNKFRGSGPFAGFYWFRRPAVFVLETS--LAKQILIKEFNKFTDRGFFHNPEDDP 115

  Fly   114 ----LLMSTGRKWH------------GRRKIITPTFHFKILEQFVEIFDQQSA----VMVEQLQS 158
                |.:..|:||.            |:.|.:.||. .|:..:|.::|.|..|    |.|.:|.:
  Fly   116 LSGQLFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTV-VKVANEFTDVFGQNVAKSPVVEVRELLA 179

  Fly   159 RADGMTPINIFPVICLTALDIIAETAMGTKINAQKNPNLPY-----------------VQAVNDV 206
            |               ...|:|...|.|.:.::.|:|:..:                 :..||..
  Fly   180 R---------------FTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSF 229

  Fly   207 TNILIKRFIHAWQRVD----WIFRLTQPTEAKRQDKAIKVMHDFTENII-RERRETLVNNSKETT 266
            .|  :.|.:|.....:    :..|:.:.|.|.|:...|: .:||.:.:| .:.:..:|:.|.|: 
  Fly   230 PN--LARRLHMKMTAEPIERFFMRIVRETVAFREQNNIR-RNDFMDQLIDLKNKPLMVSQSGES- 290

  Fly   267 PEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDEDIREEVDTFMFEGHDTTTSAISFCLYEISRHP 331
                ||                       |:.|:|..:...|...|.:|:::.:.|.|||::::.
  Fly   291 ----VN-----------------------LTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQ 328

  Fly   332 EVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPVPMIGRWFAEDVEIRG--K 394
            ::|.|:::|.::|: |.....:....:.:|.:::.|:.|:|||:..:|::.|...||.|:.|  |
  Fly   329 DIQNRVRKECQEVI-EKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPK 392

  Fly   395 HIPAGTNFTMGIFVLL------RDPEYFESPDEFRPERFDAD-VPQIHPYAYIPFSAGPRNCIGQ 452
            ::     ...|:.||:      ||.:.:.:|:.|.|:.|..: |.:.....::||..|||||||.
  Fly   393 YV-----IKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGM 452

  Fly   453 KFAMLEMKSTVSKLLRHFEL-------LPLGPEPRHSMNIVLRSAN-GVHL 495
            :|..::.:..::.|::.|:.       :|:    .::..:.|.::| |::|
  Fly   453 RFGQMQARIGLALLIKDFKFSVCEKTTIPM----TYNKEMFLIASNSGIYL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 111/538 (21%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 111/538 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.