DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and Cyp9b2

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster


Alignment Length:521 Identity:118/521 - (22%)
Similarity:203/521 - (38%) Gaps:116/521 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RPLPFLGNL---LMYRGLDPEQIMDFVKKNQRKYGRLYRVWILHQLAVF---------STDP--- 84
            :|.||:||:   .:.:.....|:.:|.::.::           |:|..|         ..||   
  Fly    37 KPYPFVGNMAAAALQKSSFQRQLTEFYERTRQ-----------HKLVGFFNMRTPMITLNDPELI 90

  Fly    85 -----RDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMSTGRKWHGRRKIITPTFHFKILEQFVEI 144
                 :|.:...:.|..||.|:  :|.|    |.|.:...::|...|..:||.|....:.....:
  Fly    91 KKVCVKDFDHFPNHQPFITSND--RLFN----DMLSVMRDQRWKHMRNTLTPVFTAAKMRNMFTL 149

  Fly   145 FDQQSAVMVEQLQSRADGMTPINIF----PVIC-LTALDIIAETAMGTKINAQKNPNLPYVQAVN 204
            .::..|..::.|.|.:..:.....|    .|:| ..:.||||.||.|.|:|:..||...:.:...
  Fly   150 MNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIGQ 214

  Fly   205 DV--------------TNI-----LIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMHDFTENI 250
            .:              |.:     |:|..|....:||:..||.......|:      .|:.|   
  Fly   215 SLVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAKVDYFARLVVEAMQYRE------KHNIT--- 270

  Fly   251 IRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDEDIREEVDTFMFEGHDT 315
                |..::....|...|.|..:                       :|::|..:...|.|...:.
  Fly   271 ----RPDMIQLLMEAKNESEDKW-----------------------TDDEIVAQCFIFFFAAFEN 308

  Fly   316 TTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPVPM 380
            .::.|....||:..:|:||:||.:||.:.......:|:|...:.::.:|:.||.||||.......
  Fly   309 NSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLAAA 373

  Fly   381 IGRWFAEDVEIRGK------HIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDAD-VPQIHPYA 438
            ..|..::|..:...      ....|....:.|..|..|..||..|.:|.|:||..: ...:.||.
  Fly   374 TDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYT 438

  Fly   439 YIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPR---------HSMNIVLRSANGVH 494
            |:||..|||||||.::|::::|..:..||.|::   :...||         ...|...||...:|
  Fly   439 YLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYK---IEASPRTIKDLWGSASGFNFTPRSGFWMH 500

  Fly   495 L 495
            |
  Fly   501 L 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 116/519 (22%)
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 112/496 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.