DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and CYP4A22

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:513 Identity:161/513 - (31%)
Similarity:271/513 - (52%) Gaps:36/513 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVVGVLLLVAFATLLLWDFL-----------WRRRGNGILPGPRPLPFLGNLLMYRGLDPEQIMD 56
            ||.|:|.:.:...|||  .|           |..:.....|.|......|::..::   .:|.:.
Human    14 GVSGILQVTSLLILLL--LLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQ---HDQELQ 73

  Fly    57 FVKKNQRKYGRLYRVWIL-HQLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMSTGR 120
            .:::..:.:......||. .::.|...|| |...|:..:.....:..||.|...:|.|||:..|:
Human    74 RIQERVKTFPSACPYWIWGGKVRVQLYDP-DYMKVILGRSDPKSHGSYKFLAPRIGYGLLLLNGQ 137

  Fly   121 KWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIAETAM 185
            .|...|:::||.||..||:.:|.:......||:::.:......:|:.:|..:.|..||.|.::|.
Human   138 TWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKSAF 202

  Fly   186 GTKINAQKNPN-LPYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMHDFTEN 249
            ..:.:.|.:.| ..|:||::|:.:::.....:|:...|.|:.||  :..:...:|.::.|..|:.
Human   203 SHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLT--SAGRWTHRACQLAHQHTDQ 265

  Fly   250 IIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTID-GAPLSDEDIREEVDTFMFEGH 313
            :|:.|:..|       ..|.|:..:.:||.:..||:||.:.:: |:.|||:|:|.||||||||||
Human   266 VIQLRKAQL-------QKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGH 323

  Fly   314 DTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPV 378
            |||.|.||:.||.::.||:.|:|.::||..:||:.  :.:|...|.::.:....|||:|||:|||
Human   324 DTTASGISWILYALATHPKHQERCREEIHGLLGDG--ASITWNHLDQMPYTTMCIKEALRLYPPV 386

  Fly   379 PMIGRWFAEDVEI-RGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDADVPQIHPYAYIPF 442
            |.|||..:..|.. .|:.:|.|....:.|:.|..:|:.:.:.:.|.|.||.....| |.:|::||
Human   387 PGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRFAPGSAQ-HSHAFLPF 450

  Fly   443 SAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPE--PRHSMNIVLRSANGVHLGLK 498
            |.|.|||||::|||.::|...:..|..||||| .|.  |.....:||:|.||:||.|:
Human   451 SGGSRNCIGKQFAMNQLKVARALTLLRFELLP-DPTRIPIPMARLVLKSKNGIHLRLR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 149/468 (32%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 150/469 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154735
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D214327at33208
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.