DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and CYP4Z1

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_835235.1 Gene:CYP4Z1 / 199974 HGNCID:20583 Length:505 Species:Homo sapiens


Alignment Length:507 Identity:163/507 - (32%)
Similarity:264/507 - (52%) Gaps:34/507 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLLLVAFATLLLWDFL-------WRRRGNGILPGPRPLPFLGNLLMYRGLDPEQIMDFVKKNQRK 64
            :||::...:|||:..:       |..|...:.|.|....|.|:...|    |.:..:...|...|
Human    15 LLLILLCMSLLLFQVIRLYQRRRWMIRALHLFPAPPAHWFYGHKEFY----PVKEFEVYHKLMEK 75

  Fly    65 YGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMSTGRKWHGRRKII 129
            |.....:|:......||....|...:|..:|.......:|:|..|:|.||:...|.||...|:|:
Human    76 YPCAVPLWVGPFTMFFSVHDPDYAKILLKRQDPKSAVSHKILESWVGRGLVTLDGSKWKKHRQIV 140

  Fly   130 TPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIAETAMGTKINAQKN 194
            .|.|:..||:.|:.:..:...:|:.:.:......:.:.:|..:.|..||.|.:.|...:.:.|.:
Human   141 KPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELFQHVSLMTLDSIMKCAFSHQGSIQLD 205

  Fly   195 PNL-PYVQAV---NDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMHDFTENIIRERR 255
            ..| .|::||   :.::|..:..|:|   ..|.:|:.:  ::.:...|..:.:|.|||.:|::|:
Human   206 STLDSYLKAVFNLSKISNQRMNNFLH---HNDLVFKFS--SQGQIFSKFNQELHQFTEKVIQDRK 265

  Fly   256 ETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTIDGA-PLSDEDIREEVDTFMFEGHDTTTSA 319
            |:|.:..|:.|.        ||||...||:||.:..:.. ..|:.|::.||.||||.|||||:||
Human   266 ESLKDKLKQDTT--------QKRRWDFLDILLSAKSENTKDFSEADLQAEVKTFMFAGHDTTSSA 322

  Fly   320 ISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPVPMIGRW 384
            ||:.||.::::||.|||.:.|||::||:.  |.:|...|.::.:....|||.|||:.||..|.|.
Human   323 ISWILYCLAKYPEHQQRCRDEIRELLGDG--SSITWEHLSQMPYTTMCIKECLRLYAPVVNISRL 385

  Fly   385 FAEDVEI-RGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDAD-VPQIHPYAYIPFSAGPR 447
            ..:.:.. .|:.:|||....:.|:.|..:|.::|.|..|.|.||..: ..:|||||:||||||.|
Human   386 LDKPITFPDGRSLPAGITVFINIWALHHNPYFWEDPQVFNPLRFSRENSEKIHPYAFIPFSAGLR 450

  Fly   448 NCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPRHSM-NIVLRSANGVHLGLK 498
            |||||.||::|.|..|:..|..|:|.|....|...: .:||:|.||:|:..|
Human   451 NCIGQHFAIIECKVAVALTLLRFKLAPDHSRPPQPVRQVVLKSKNGIHVFAK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 154/470 (33%)
CYP4Z1NP_835235.1 p450 47..500 CDD:278495 155/471 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D214327at33208
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.