DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and CYP46A1

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_006659.1 Gene:CYP46A1 / 10858 HGNCID:2641 Length:500 Species:Homo sapiens


Alignment Length:520 Identity:158/520 - (30%)
Similarity:256/520 - (49%) Gaps:60/520 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVGVLLLVAFATLLLWDFLWRRRGN-GILPG-PRPLPFLGNLLMYRGLD-------PEQIMDFVK 59
            ::|..:|:||.  |...|:.|.|.. ..:|| |||...||:|..:...|       .:..:|:.|
Human     7 LLGSAVLLAFG--LCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAK 69

  Fly    60 KNQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGD-----GLLMSTG 119
                |||.:.||.:.|:.:|..|.|..::..|.|.::...:.:|:.|....|:     ||:....
Human    70 ----KYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECN 130

  Fly   120 -RKWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIAET 183
             .:||.:|::|...|....|...:|.|::::..:||.|:::|||.||:::..::..||:||:|:.
Human   131 YERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKA 195

  Fly   184 AMGTK----INAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMH 244
            |.|.:    :.|||    |..|||.     |:...|.|.:.....|...:..:.:...::|:.:.
Human   196 AFGMETSMLLGAQK----PLSQAVK-----LMLEGITASRNTLAKFLPGKRKQLREVRESIRFLR 251

  Fly   245 DFTENIIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQ--STIDGAPLSDEDIREEVDT 307
            ....:.::.|||.|...       |||.          .|:|.|  ...:||. .||.:.:...|
Human   252 QVGRDWVQRRREALKRG-------EEVP----------ADILTQILKAEEGAQ-DDEGLLDNFVT 298

  Fly   308 FMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESL 372
            |...||:|:.:.::|.:.|:||.||:..|||.|:.:|:|..|.  :...|||.|:::..|:||||
Human   299 FFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRY--LDFEDLGRLQYLSQVLKESL 361

  Fly   373 RLHPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDADVPQIHPY 437
            ||:||.....|...|:..|.|..:|..|......:|:.|...|||.|..|.|:||....|:.. :
Human   362 RLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPR-F 425

  Fly   438 AYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPRHSM--NIVLRSANGVHLGLKPR 500
            .|.|||.|.|:||||:||.:|:|..::|||:..| ..|.|..|..:  ...|:..:.|...|:||
Human   426 TYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLE-FRLVPGQRFGLQEQATLKPLDPVLCTLRPR 489

  Fly   501  500
            Human   490  489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 147/484 (30%)
CYP46A1NP_006659.1 p450 34..466 CDD:365848 144/466 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.