DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.5A and Ndufa7

DIOPT Version :9

Sequence 1:NP_001284805.1 Gene:ND-B14.5A / 31190 FlyBaseID:FBgn0025839 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_075691.1 Gene:Ndufa7 / 66416 MGIID:1913666 Length:113 Species:Mus musculus


Alignment Length:92 Identity:44/92 - (47%)
Similarity:59/92 - (64%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIQRIRAFLLGR--EHNLALRFEDGLADRTQPQPEIPDGPSHLLSANYYCQRDGRREVLPPIDLV 73
            :||::|.:..|:  :..|.||::: :|.||||.|::|.||||.||.||||.|||||||:||..::
Mouse     7 VIQKLRNWASGQDLQAKLQLRYQE-IAKRTQPPPKLPVGPSHKLSNNYYCTRDGRREVVPPSIIM 70

  Fly    74 EQQKQL----AAEGEAAKAPSSKLPTP 96
            ..||.|    |||..|..|...|..||
Mouse    71 SSQKALVSGKAAESSAMAATEKKAVTP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.5ANP_001284805.1 CI-B14_5a 9..99 CDD:284707 44/92 (48%)
Ndufa7NP_075691.1 CI-B14_5a 5..102 CDD:311349 44/92 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..113 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849950
Domainoid 1 1.000 79 1.000 Domainoid score I8725
eggNOG 1 0.900 - - E1_KOG4630
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5208
Isobase 1 0.950 - 0 Normalized mean entropy S5028
OMA 1 1.010 - - QHG48369
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006420
OrthoInspector 1 1.000 - - otm42335
orthoMCL 1 0.900 - - OOG6_107400
Panther 1 1.100 - - LDO PTHR12485
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3456
SonicParanoid 1 1.000 - - X4686
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.