DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.5A and ndufa7

DIOPT Version :9

Sequence 1:NP_001284805.1 Gene:ND-B14.5A / 31190 FlyBaseID:FBgn0025839 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001003436.1 Gene:ndufa7 / 445042 ZFINID:ZDB-GENE-040801-169 Length:104 Species:Danio rerio


Alignment Length:90 Identity:41/90 - (45%)
Similarity:60/90 - (66%) Gaps:4/90 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIQRIRAFLLGR--EHNLALRFEDGLADRTQPQPEIPDGPSHLLSANYYCQRDGRREVLPPIDLV 73
            :|||:|.:|.|:  :..|.||:.: :|.||||.|::|.||||..:.||||.||||||::||..::
Zfish     7 IIQRLRNYLSGQDLQSKLQLRYTE-VAKRTQPPPKLPVGPSHKFANNYYCTRDGRREMVPPTVIM 70

  Fly    74 EQQKQLAAEGEAAKAPSSKLPTPGK 98
            ..||.|.|..||:..|..:: .||:
Zfish    71 SSQKALTAGSEASGKPKHQV-VPGQ 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.5ANP_001284805.1 CI-B14_5a 9..99 CDD:284707 41/90 (46%)
ndufa7NP_001003436.1 CI-B14_5a 5..95 CDD:284707 41/90 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595770
Domainoid 1 1.000 79 1.000 Domainoid score I8657
eggNOG 1 0.900 - - E1_KOG4630
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5215
OMA 1 1.010 - - QHG48369
OrthoDB 1 1.010 - - D1465659at2759
OrthoFinder 1 1.000 - - FOG0006420
OrthoInspector 1 1.000 - - otm26393
orthoMCL 1 0.900 - - OOG6_107400
Panther 1 1.100 - - LDO PTHR12485
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3456
SonicParanoid 1 1.000 - - X4686
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.