DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.5A and Ndufa7

DIOPT Version :9

Sequence 1:NP_001284805.1 Gene:ND-B14.5A / 31190 FlyBaseID:FBgn0025839 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001100242.2 Gene:Ndufa7 / 299643 RGDID:1304597 Length:112 Species:Rattus norvegicus


Alignment Length:99 Identity:41/99 - (41%)
Similarity:59/99 - (59%) Gaps:7/99 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIQRIRAFLLGR--EHNLALRFEDGLADRTQPQPEIPDGPSHLLSANYYCQRDGRREVLPPIDLV 73
            :||::|.:..|:  :..|.||::: :|.||||.|::|.||||.||.||||.|||||||:||..::
  Rat     7 VIQKLRNWASGQDLQAKLQLRYQE-IAKRTQPPPKLPVGPSHKLSNNYYCTRDGRREVVPPSIIM 70

  Fly    74 EQQKQL----AAEGEAAKAPSSKLPTPGKVYAWD 103
            ..||.|    .||..|..|....:.....:..|:
  Rat    71 SSQKALVSGKTAESSAVAATKRAVTPAPPMKRWE 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.5ANP_001284805.1 CI-B14_5a 9..99 CDD:284707 40/93 (43%)
Ndufa7NP_001100242.2 CI-B14_5a 5..99 CDD:284707 40/92 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353627
Domainoid 1 1.000 73 1.000 Domainoid score I9073
eggNOG 1 0.900 - - E1_KOG4630
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5181
OMA 1 1.010 - - QHG48369
OrthoDB 1 1.010 - - D1465659at2759
OrthoFinder 1 1.000 - - FOG0006420
OrthoInspector 1 1.000 - - otm44394
orthoMCL 1 0.900 - - OOG6_107400
Panther 1 1.100 - - LDO PTHR12485
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4686
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.