DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.5A and ndufa7

DIOPT Version :9

Sequence 1:NP_001284805.1 Gene:ND-B14.5A / 31190 FlyBaseID:FBgn0025839 Length:103 Species:Drosophila melanogaster
Sequence 2:XP_004911066.1 Gene:ndufa7 / 100492017 XenbaseID:XB-GENE-1006606 Length:115 Species:Xenopus tropicalis


Alignment Length:95 Identity:41/95 - (43%)
Similarity:57/95 - (60%) Gaps:11/95 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IQRIRAFLLGR--EHNLALRFEDGLADRTQPQPEIPDGPSHLLSANYYCQRDGRREVLPPIDLVE 74
            |||:|....|:  :..|.||:.: ::.||||.|.:|.||||.|:.||||.||||||..||:.::.
 Frog     8 IQRLRNLASGKDLQAKLQLRYTE-ISKRTQPPPNLPVGPSHKLADNYYCTRDGRRESYPPLVIMS 71

  Fly    75 QQKQLAAEGEA-------AKAPSSKLPTPG 97
            ..|.|.:.|:|       |||..:.: |||
 Frog    72 PYKALPSGGQASGTETAIAKAARNAV-TPG 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.5ANP_001284805.1 CI-B14_5a 9..99 CDD:284707 41/95 (43%)
ndufa7XP_004911066.1 CI-B14_5a 5..102 CDD:369326 41/95 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I9876
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48369
OrthoDB 1 1.010 - - D1465659at2759
OrthoFinder 1 1.000 - - FOG0006420
OrthoInspector 1 1.000 - - otm47441
Panther 1 1.100 - - LDO PTHR12485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4686
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.