DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3630 and abrab

DIOPT Version :9

Sequence 1:NP_001259177.1 Gene:CG3630 / 31189 FlyBaseID:FBgn0023540 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001003986.1 Gene:abrab / 445477 ZFINID:ZDB-GENE-040822-7 Length:359 Species:Danio rerio


Alignment Length:149 Identity:60/149 - (40%)
Similarity:89/149 - (59%) Gaps:17/149 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SPLSSKVAMFNNQATQHKQSQLLNPFSQD---GRAASPKPTFSKDQYGKPLAGSLTEMRGQKANI 78
            |.:.:..:.:.|.|::|..:|.|||||:|   ..:.|.:....::.||:|..||.|..|.::|..
Zfish   218 STVGNLKSRWQNWASEHTINQKLNPFSEDFDYEYSMSTRLHKGEEGYGRPKEGSKTAERAKRAEK 282

  Fly    79 HVMKEMLELCQIINS------EGYDVKDEPTMRVIPFGELFNIYNYISDKVVGILLRARKHKLVD 137
            |:.:|:.::|.:|.:      :||        ..:.|||||:.|..|||||||||:|||||..|.
Zfish   283 HIHREIDDMCFVIRTMADPDPDGY--------TRVTFGELFDRYVRISDKVVGILMRARKHGKVA 339

  Fly   138 FEGEMLYQRRDDDVPVFLL 156
            ||||||:|.:||||.:.||
Zfish   340 FEGEMLWQGQDDDVIITLL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3630NP_001259177.1 Costars 79..155 CDD:291377 38/81 (47%)
abrabNP_001003986.1 Costars 283..357 CDD:291377 38/81 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577586
Domainoid 1 1.000 81 1.000 Domainoid score I8451
eggNOG 1 0.900 - - E1_KOG3376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002921
OrthoInspector 1 1.000 - - mtm6516
orthoMCL 1 0.900 - - OOG6_107089
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3023
SonicParanoid 1 1.000 - - X2739
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.630

Return to query results.
Submit another query.