DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3630 and CG2113

DIOPT Version :9

Sequence 1:NP_001259177.1 Gene:CG3630 / 31189 FlyBaseID:FBgn0023540 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_647757.2 Gene:CG2113 / 38356 FlyBaseID:FBgn0035384 Length:183 Species:Drosophila melanogaster


Alignment Length:177 Identity:73/177 - (41%)
Similarity:114/177 - (64%) Gaps:5/177 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DSPLSSKVAMFNNQATQHKQSQLLNPFSQDGRAASPKPTFSKDQYGKPLAGSLTEMRGQKANIHV 80
            ||.:||::.:||.||.|||...::|||:.......||.||.:::||:...|||:|.|..:||:..
  Fly    10 DSSVSSRITLFNQQAEQHKNWMMINPFAHYNVNEMPKRTFPEEEYGRAPTGSLSEQRSLQANVRA 74

  Fly    81 MKEMLELCQIINSEGYDVKDEPT--MRVIPFGELFNIYNYISDKVVGILLRARKHKLVDFEGEML 143
            ::|:|:||.:|...|   :|:|.  .:|:.||:||..||.||||::..||.|||:..|||.||.|
  Fly    75 LEEILQLCDLIQKSG---RDDPIDGRKVLAFGQLFETYNNISDKLLATLLGARKYGFVDFSGETL 136

  Fly   144 YQRRDDDVPVFLLKPIKEIRSEMEAKIEDIKRAASPAPPQSTSVLMD 190
            :|.|||..||.||:|.:|:::|:.:|:.|::...:..|.:.|.:..|
  Fly   137 FQGRDDTEPVRLLRPFEELQAEIISKVADLRCDFTEKPEEPTLLRED 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3630NP_001259177.1 Costars 79..155 CDD:291377 36/77 (47%)
CG2113NP_647757.2 Costars 75..148 CDD:291377 36/75 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469309
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3376
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002921
OrthoInspector 1 1.000 - - mtm6516
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22739
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.