DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3630 and abraa

DIOPT Version :9

Sequence 1:NP_001259177.1 Gene:CG3630 / 31189 FlyBaseID:FBgn0023540 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_699540.2 Gene:abraa / 324520 ZFINID:ZDB-GENE-120730-1 Length:346 Species:Danio rerio


Alignment Length:139 Identity:61/139 - (43%)
Similarity:78/139 - (56%) Gaps:23/139 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ATQHKQSQLLNPFSQDGRAASPKPTFSKDQ------------YGKPLAGSLTEMRGQKANIHVMK 82
            |..|.:.|.|||||::         |..|.            ||:|..||.|..|..:|..|:.:
Zfish   218 AEDHMEGQKLNPFSEE---------FDYDHAMATRLHKGDAGYGRPKEGSKTAQRADRAQKHIYR 273

  Fly    83 EMLELCQIINSEGYDVKDEPTMRVIPFGELFNIYNYISDKVVGILLRARKHKLVDFEGEMLYQRR 147
            ||.|:|.||...|.  :|:.....:.||.||:.|..|||||||||||.||||:||||||||::.:
Zfish   274 EMEEMCFIIRDMGQ--QDKQGQIWVTFGRLFDRYVKISDKVVGILLRCRKHKMVDFEGEMLWKGQ 336

  Fly   148 DDDVPVFLL 156
            ||||.:.||
Zfish   337 DDDVIITLL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3630NP_001259177.1 Costars 79..155 CDD:291377 41/75 (55%)
abraaXP_699540.2 Costars 270..344 CDD:291377 41/75 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577588
Domainoid 1 1.000 81 1.000 Domainoid score I8451
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002921
OrthoInspector 1 1.000 - - mtm6516
orthoMCL 1 0.900 - - OOG6_107089
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2739
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.