DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3630 and F36F2.1

DIOPT Version :9

Sequence 1:NP_001259177.1 Gene:CG3630 / 31189 FlyBaseID:FBgn0023540 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_492426.1 Gene:F36F2.1 / 172722 WormBaseID:WBGene00009475 Length:162 Species:Caenorhabditis elegans


Alignment Length:169 Identity:72/169 - (42%)
Similarity:96/169 - (56%) Gaps:15/169 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VDSPLSSKVAMFNNQATQHKQSQLLNPFSQDGRAASPKPTFSKDQYGKPLAGSLTEMRGQKANIH 79
            :|..:.....|..|.|||.|.......|:|      .|...|..:||:|..|:|||.|.:||..|
 Worm     8 IDKTIFKFKEMEQNVATQSKDDVYSKDFTQ------KKMDKSSSEYGRPKPGTLTEQRAKKAAAH 66

  Fly    80 VMKEMLELCQIINSEGYDVKDEPTMRVIPFGELFNIYNYISDKVVGILLRARKHKLVDFEGEMLY 144
            |.:|||.||:::...|...|:...:| |.||.||.||..|||||||.||||||||::|||||||:
 Worm    67 VHREMLTLCEVVEDYGKQEKEGDPIR-ITFGRLFTIYVNISDKVVGTLLRARKHKMIDFEGEMLF 130

  Fly   145 QRRDDDVPVFLLKPIKEIRSEMEAKIEDIKRAASPAPPQ 183
            |:|||.|.:.||.        ..|::::..||.:.|.|:
 Worm   131 QKRDDHVIITLLL--------SGAQLKEAIRAHAAANPK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3630NP_001259177.1 Costars 79..155 CDD:291377 44/75 (59%)
F36F2.1NP_492426.1 Costars 66..141 CDD:373238 44/75 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166808
Domainoid 1 1.000 91 1.000 Domainoid score I4911
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002921
OrthoInspector 1 1.000 - - otm14736
orthoMCL 1 0.900 - - OOG6_107089
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3023
SonicParanoid 1 1.000 - - X2739
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.