DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3630 and ABRA

DIOPT Version :9

Sequence 1:NP_001259177.1 Gene:CG3630 / 31189 FlyBaseID:FBgn0023540 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_631905.1 Gene:ABRA / 137735 HGNCID:30655 Length:381 Species:Homo sapiens


Alignment Length:144 Identity:64/144 - (44%)
Similarity:89/144 - (61%) Gaps:5/144 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SPLSSKVAMFNNQATQHKQSQLLNPFSQD---GRAASPKPTFSKDQYGKPLAGSLTEMRGQKANI 78
            ||:.:....:...|.:|.|||.|||||::   ..|.|.:.....:.||:|..|:.|..|.::|..
Human   240 SPVGNLKGRWQQWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAKRAEE 304

  Fly    79 HVMKEMLELCQIINSEGYDVKDEPTMRVIPFGELFNIYNYISDKVVGILLRARKHKLVDFEGEML 143
            |:.:||:::|.||.:.....:|....  :.||:||:.|..|||||||||:|||||.|||||||||
Human   305 HIYREMMDMCFIICTMARHRRDGKIQ--VTFGDLFDRYVRISDKVVGILMRARKHGLVDFEGEML 367

  Fly   144 YQRRDDDVPVFLLK 157
            :|.|||.|.:.|||
Human   368 WQGRDDHVVITLLK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3630NP_001259177.1 Costars 79..155 CDD:291377 40/75 (53%)
ABRANP_631905.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..207
Actin-binding 1. /evidence=ECO:0000250 199..299 19/58 (33%)
Interaction with actin. /evidence=ECO:0000250|UniProtKB:Q8BUZ1 240..285 14/44 (32%)
Actin-binding 2. /evidence=ECO:0000250 300..381 42/82 (51%)
Costars 305..379 CDD:317149 40/75 (53%)
Interaction with actin. /evidence=ECO:0000250|UniProtKB:Q8BUZ1 352..381 20/28 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144476
Domainoid 1 1.000 79 1.000 Domainoid score I8750
eggNOG 1 0.900 - - E1_KOG3376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002921
OrthoInspector 1 1.000 - - otm40349
orthoMCL 1 0.900 - - OOG6_107089
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3023
SonicParanoid 1 1.000 - - X2739
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.630

Return to query results.
Submit another query.