DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3630 and abra

DIOPT Version :9

Sequence 1:NP_001259177.1 Gene:CG3630 / 31189 FlyBaseID:FBgn0023540 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001106590.1 Gene:abra / 100127806 XenbaseID:XB-GENE-948438 Length:227 Species:Xenopus tropicalis


Alignment Length:142 Identity:63/142 - (44%)
Similarity:84/142 - (59%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PLSSKVAMFNNQATQHKQSQLLNPFSQ--DGRAASPKPTFSKDQ-YGKPLAGSLTEMRGQKANIH 79
            |:::....:...:.||..:|.|||||:  |...|..:.....|: ||.|..|:.|..|..:|..|
 Frog    88 PVNNIKGKWEKWSNQHALTQKLNPFSEEFDHEFAMSRRLHKGDKGYGHPEEGTKTAERAMRAEAH 152

  Fly    80 VMKEMLELCQIINSEGYDVKDEPTMRVIPFGELFNIYNYISDKVVGILLRARKHKLVDFEGEMLY 144
            :.:||.:||.||::.....||....  :.|||||:.|..|||||||||||||||.:|||.||||:
 Frog   153 IHREMKDLCFIISTMSKPGKDGKVR--VTFGELFDRYVRISDKVVGILLRARKHDMVDFPGEMLW 215

  Fly   145 QRRDDDVPVFLL 156
            |.|||.|.:.||
 Frog   216 QGRDDHVIITLL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3630NP_001259177.1 Costars 79..155 CDD:291377 42/75 (56%)
abraNP_001106590.1 Costars 152..226 CDD:291377 42/75 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8474
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002921
OrthoInspector 1 1.000 - - mtm9342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3023
SonicParanoid 1 1.000 - - X2739
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.