DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3630 and si:dkey-29b11.3

DIOPT Version :9

Sequence 1:NP_001259177.1 Gene:CG3630 / 31189 FlyBaseID:FBgn0023540 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001373321.1 Gene:si:dkey-29b11.3 / 100007775 ZFINID:ZDB-GENE-100922-178 Length:173 Species:Danio rerio


Alignment Length:138 Identity:61/138 - (44%)
Similarity:85/138 - (61%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ATQHKQSQLLNPFSQDGRAASPKPTFSKDQYGKPLAGSLTEMRGQKANIHVMKEMLELCQIINSE 94
            :.:|.::|..|||| :|....|:....::.||:||.||.||.||:.|:..:.:|:.||||:|...
Zfish    33 SNEHCENQKKNPFS-NGMVTPPQIQRGQEGYGRPLEGSKTEQRGKDAHFLMNREVTELCQVIREI 96

  Fly    95 GYDVKDEPTMRVIPFGELFNIYNYISDKVVGILLRARKHKLVDFEGEMLYQRRDDDVPVFLLKPI 159
            |....|..|  .:.||.||..|..||:|:||:||||||..||.||||||:|.|||.|.:.|   |
Zfish    97 GQSGDDGRT--AVRFGTLFERYVNISNKLVGVLLRARKQGLVHFEGEMLWQGRDDGVIITL---I 156

  Fly   160 KEIRSEME 167
            :...:||:
Zfish   157 QGFTAEMD 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3630NP_001259177.1 Costars 79..155 CDD:291377 38/75 (51%)
si:dkey-29b11.3NP_001373321.1 Costars 82..155 CDD:405405 38/74 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577584
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3376
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136644
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002921
OrthoInspector 1 1.000 - - mtm6516
orthoMCL 1 0.900 - - OOG6_107089
Panther 1 1.100 - - LDO PTHR22739
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2739
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.740

Return to query results.
Submit another query.