DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d1 and CYP702A1

DIOPT Version :9

Sequence 1:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:510 Identity:105/510 - (20%)
Similarity:199/510 - (39%) Gaps:138/510 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PGPPVLPLVGHGHHFIGKPPHEMVKKIFEFMETYSKDQVLKVWLGPELNVLMGNPK-----DVEV 94
            ||....|::|....|:  .||:    .|:| .|:.|:::::  .||.....:...|     |:|:
plant    37 PGSMGFPIIGETFEFM--KPHD----AFQF-PTFIKERIIR--YGPIFRTSLFGAKVIISTDIEL 92

  Fly    95 VLGTLRFNDKAGEYKALEPWLKEGLLVSRGRKWHKRRKIITPAFHFKILDQFVEVFEKGSRDLLR 159
            .:...:.|...|..|::.....|..|..:.::.||..:.:|    |::|         ||:.|..
plant    93 NMEIAKTNHAPGLTKSIAQLFGENNLFFQSKESHKHVRNLT----FQLL---------GSQGLKL 144

  Fly   160 NMEQDRLKHGDSGFSLYDWINLCTMDTICETAMGVSINAQSNADSEYVQAV-KTIS--------- 214
            ::.||              |:|.|...:.|.|....::.:..:....::.: |.::         
plant   145 SVMQD--------------IDLLTRTHMEEGARRGCLDVKEISSKILIECLAKKVTGDMEPEAAK 195

  Fly   215 -MVLHKRMF-NILYRFDLTYMLTPLARAEKKALNVLHQFTEKIIVQRR--EEL------IREGSS 269
             :.|..|.| :..:||.|....|.:.:..|....:||...|.|:.:|.  |||      |.|| :
plant   196 ELALCWRCFPSGWFRFPLNLPGTGVYKMMKARKRMLHLLKETILKKRASGEELGEFFKIIFEG-A 259

  Fly   270 QESSNDDADVGAKRKMAFLDILLQSTVDERPLSNLDIREEVDTFMFEGHDTTSSALMFFFYNIAT 334
            :..|.|:|                             .|.:.|.....::||...|......|:.
plant   260 ETMSVDNA-----------------------------IEYIYTLFLLANETTPRILAATIKLISD 295

  Fly   335 HPEAQKKCFEEIRSVV--GNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEIN 397
            :|:..|:...|...:|  ..:|.|.:::|....:.:..:.:.|:||:..:.|.:.|....:.::.
plant   296 NPKVMKELHREHEGIVRGKTEKETSITWEEYKSMTFTQMVINESLRITSTAPTVFRIFDHEFQVG 360

  Fly   398 GKLIPAGTNIGISPLYLGR-----REELFSEPNIFKPERFD------VVTTAEKLNPYAYIPFSA 451
            ...||||.      :::|.     ..:.:.:|.:|.|.|::      :|:.       .||||.|
plant   361 SYKIPAGW------IFMGYPNNHFNPKTYDDPLVFNPWRWEGKDLGAIVSR-------TYIPFGA 412

  Fly   452 GPRNCIGQKFAMLEIKAIV-------------ANVLRHY--------EVDFVGDS 485
            |.|.|:|.:||.|::...:             ..:||::        ||.|:.|:
plant   413 GSRQCVGAEFAKLQMAIFIHHLSRDRWSMKIGTTILRNFVLMFPNGCEVQFLKDT 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 105/510 (21%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 99/481 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.