DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:259 Identity:54/259 - (20%)
Similarity:95/259 - (36%) Gaps:67/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PPVLPLVGHGHHFIGKPPHEMVKKIFEFMETYSKDQVLKVWLGPELNVLMGNPKDVEVVLG--TL 99
            |.::|.:   ||.:.|  |.  ||.|             .|.||..||::.:|:.:..::.  .|
plant    81 PRMMPFL---HHTVLK--HG--KKCF-------------TWYGPYPNVIVMDPETLREIMSKHEL 125

  Fly   100 RFNDKAGEYKALEPWLKEGLLVSRGRKWHKRRKIITPAFHFKILDQFVEVFEKGSRDLLRNMEQD 164
            ....|.|.:..:   ...|||...|.||.|.|.|:.|||....|...:..|....:::|.  |.:
plant   126 FPKPKIGSHNHV---FLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLE--EWE 185

  Fly   165 RLKHGDSGFSLYDWINLC---TMDTICETAMGVSIN--------AQSNAD-------SEYVQAVK 211
            ||........|..|.: |   |.:.:...:.|.|..        .|...|       :.|:...|
plant   186 RLASAKGTMELDSWTH-CHDLTRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIRAVYIPGSK 249

  Fly   212 TISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNVLHQFTEKIIVQRREELIREGSSQESSND 275
            .:....::|:                 |..::.:..:.    |.:::.:||.|:.|...:.::|
plant   250 FLPTKFNRRL-----------------RETERDMRAMF----KAMIETKEEEIKRGRGTDKNSD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 54/259 (21%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.