DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d1 and AT5G51900

DIOPT Version :9

Sequence 1:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_200003.1 Gene:AT5G51900 / 835265 AraportID:AT5G51900 Length:242 Species:Arabidopsis thaliana


Alignment Length:284 Identity:65/284 - (22%)
Similarity:108/284 - (38%) Gaps:80/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 EKKALN---VLHQFTEKIIVQRREELIREGSSQESSND----DADVGAKRKMAFLDILLQSTVDE 298
            |||.:.   :..:...|.|..||||:.|   ||.::||    |:..........||......:| 
plant    22 EKKMIEAGAIFDRVCGKYISARREEVKR---SQVNNNDHFIRDSHANLLTSHIKLDTTQYQLLD- 82

  Fly   299 RPLSNLDIREEVDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEI-----RSVVGNDKSTPV 358
             |:::..:|:.|...:..|.|||:|||.:||:.::.:|....|..:||     ||..|.::.:..
plant    83 -PINDKFLRDNVFALLLAGRDTTASALTWFFWFLSENPLVVTKIRQEIDMNLPRSCSGQERPSCD 146

  Fly   359 SYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEINGKLIPAGTNIGISPLYLGRR-EELFS 422
            ..|.||                        |..|.|                   :||| ..:.:
plant   147 PMEYLN------------------------KDDESC-------------------MGRRCIRIQA 168

  Fly   423 EPNIFKPERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVDFV-GDSS 486
            ....|:..|               :......|.|.|::.||:::|.:...:|::|::... |...
plant   169 REMDFRDRR---------------VSIQCRSRICHGKQRAMVQMKIVAVEILQNYDIKVANGQKF 218

  Fly   487 EPPVLIAELILRTKEPLMFKVRER 510
            ||.   ..|||:.|.....|:.:|
plant   219 EPD---TSLILKMKHGFKVKINKR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 63/279 (23%)
AT5G51900NP_200003.1 p450 <2..239 CDD:299894 64/282 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.