DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d1 and CYP702A8

DIOPT Version :9

Sequence 1:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_189648.1 Gene:CYP702A8 / 822729 AraportID:AT3G30290 Length:408 Species:Arabidopsis thaliana


Alignment Length:253 Identity:53/253 - (20%)
Similarity:109/253 - (43%) Gaps:48/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 LARAEKKALNVLHQFTEKIIVQRREELIREGSSQESSNDDADV------GAKRKMAFLDILLQST 295
            :.:|.|:...:|           :||::::..:.|...:.:.:      |.|..|:..:::    
plant   154 MMKARKRMKTLL-----------KEEVLKKREAGEEFGEFSKIIFGEKEGEKETMSMKNVI---- 203

  Fly   296 VDERPLSNLDIREEVDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGN-DKSTPVS 359
                        |.:.||....::||...|......|:.:|:..::...|...:..| .:...::
plant   204 ------------EYIYTFFVIANETTPRILAATVKFISENPKVMQELQREHAMIFENKSEEAGLT 256

  Fly   360 YELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEINGKLIPAGTN-IGISPLYLGRREELFSE 423
            :|....:.:.::.:.|:||:..:||::.||...|.::....||||.| :|....:....:  :.:
plant   257 WEDYKSMTFTNMVINESLRISTTVPVILRKPDHDTKVGDYTIPAGWNFMGYPSAHFDPTK--YED 319

  Fly   424 PNIFKPERF-----DVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRH 476
            |..|.|.|:     |.:.:..      ||||.||||.|:|..||.|.:...:.::.|:
plant   320 PLEFNPWRWKGNDLDAIVSTN------YIPFGAGPRLCVGAYFAKLLMAIFIHHLCRY 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 53/253 (21%)
CYP702A8NP_189648.1 p450 5..374 CDD:299894 53/253 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.