DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d1 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:522 Identity:163/522 - (31%)
Similarity:284/522 - (54%) Gaps:45/522 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVIGAILASALFVGLLLYHLKFKRLIDLISYMPGPPVLPLVGHGHHFIGKPPHEMVKKIFEFM 65
            :.|.:...||..|...:.|| |:.:||:..:|..||||...|:|| ..|:.:          :.|
Mouse    14 LHLALVFCLALVLMQAMKLY-LRRQRLLRDLSPFPGPPAHWLLGH-QKFLQE----------DNM 66

  Fly    66 ETYSKDQVLK-------VWLGP-ELNVLMGNPKDVEVVLGTLRFNDKAGEY--KALEPWLKEGLL 120
            ||.  |:::|       .|:|| :....:.:|...::.|..   .|...:|  :.|.|.:..|||
Mouse    67 ETL--DEIVKKHPCAFPCWVGPFQAFFYIYDPDYAKIFLSR---TDPKMQYLHQLLTPCIGRGLL 126

  Fly   121 VSRGRKWHKRRKIITPAFHFKILDQFVEVFEKGSRDLLRNMEQDRLKHGDSGFSLYDWINLCTMD 185
            ...|.:|.:.|.::|||||..||...|:......:.:|...|: .....::...:::.|||.|:|
Mouse   127 NLDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKVMLDKWEK-MWTTQETTIEVFEHINLMTLD 190

  Fly   186 TICETAMGVSINAQSNADSE-YVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNVLH 249
            .|.:.|.|...|.|.|...| ||:|...:..::..|::|..:..|:.:.|:|.....::...|:|
Mouse   191 IIMKCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKLSPKGHCFQELGKVIH 255

  Fly   250 QFTEKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTV-DERPLSNLDIREEVDTF 313
            |:||||| |.|:::::....|:.:        :....||||:|.:.. |||..|:.|:|.||:||
Mouse   256 QYTEKII-QDRKKILKNQVKQDDT--------QTSQIFLDIVLSAQAEDERAFSDADLRAEVNTF 311

  Fly   314 MFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLR 378
            |:.|||.:::::.:..|.:|.:||.|.:|..||||::|:..|  :::|.|:::.|..:|:|||||
Mouse   312 MWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSS--ITWEQLDEMSYTTMCIKETLR 374

  Fly   379 MYPSVPLLGRKVLEDCEI-NGKLIPAGTNIGISPLYLGRREELFSEPNIFKPERFDVVTTAEKLN 442
            :.|.||.:.|::.:...: :|..:|||..:.:|...|.....::::|.:|.|.|| ....:::.:
Mouse   375 LIPPVPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPLRF-TKENSDQRH 438

  Fly   443 PYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTKEPLMFKV 507
            |.|::|||:||||||||:|||||:|..:|.:|.|::|  ..|.:.||...:..:||.|..:...:
Mouse   439 PCAFLPFSSGPRNCIGQQFAMLELKVAIALILLHFQV--APDLTRPPAFSSHTVLRPKHGIYLHL 501

  Fly   508 RE 509
            ::
Mouse   502 KK 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 153/484 (32%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 153/482 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3670
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.