DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d1 and Cyp4f37

DIOPT Version :10

Sequence 1:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001093657.1 Gene:Cyp4f37 / 677156 MGIID:3780112 Length:546 Species:Mus musculus


Alignment Length:91 Identity:21/91 - (23%)
Similarity:31/91 - (34%) Gaps:43/91 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ESAFNRLRKCFKYR---SISPPRSRAPF------PPPP----TITAPNPAP-------------- 58
            :|:.:|||:..|.:   ..:|..:.||.      |..|    .:.|.||.|              
Mouse   344 QSSKDRLRRRLKEKVPDIPNPTETSAPLRCVLCVPHTPQDEVAVEASNPQPNKMDRLTEILNSMR 408

  Fly    59 ----------TAFGEE------SDEM 68
                      |:|.||      |:||
Mouse   409 NNSSDVDAKLTSFMEEAQNSTNSEEM 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d1NP_476907.2 CYP4 73..504 CDD:410721
Cyp4f37NP_001093657.1 CYP4F 74..515 CDD:410772 21/91 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.