DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d1 and Cyp6a17

DIOPT Version :9

Sequence 1:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster


Alignment Length:438 Identity:117/438 - (26%)
Similarity:197/438 - (44%) Gaps:59/438 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 DVEVVLGTL-----RFNDKAGEYKALEPWLKEGLLVSRGRKWHKRRKIITPAF-HFKILDQFVEV 149
            |:|::...|     .|.::...|..::..|...|....|:||...|..:||.| ..|:.:.|..|
  Fly    84 DMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIV 148

  Fly   150 FEKGSRDLLRNMEQDRL----KHGDSG--FSLYDWINLCTMDTICETAMGVSINAQSNADSEYVQ 208
            .:.|.       |.|::    ...|.|  ..:.|.:...|.|.|...|.|::.|:..:..:|:|.
  Fly   149 VKVGE-------EMDKVFRSKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVS 206

  Fly   209 AVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNV--LHQFTEKIIVQRREELIREGSSQE 271
            ..|  ..:...|..|:|..|  .:....|:|..:..||:  ...|..||:   ||.:.....::|
  Fly   207 IGK--RAITEHRYGNMLDIF--LFGFPKLSRRLRLKLNIQEAEDFYTKIV---RETIDYRLRTKE 264

  Fly   272 SSNDDADVGAKRKMAFLDILL------QSTVDERPLSNLDIREEVDTFMFEGHDTTSSALMFFFY 330
            ..||           |:|.|:      ||...|..|:..::..:...|...|.:|:|:.:.|..|
  Fly   265 KRND-----------FMDSLIEMYKNEQSGNSEDGLTFNELLAQAFIFFVAGFETSSTTMGFALY 318

  Fly   331 NIATHPEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCE 395
            .:|.:.:.|.|..|||.:|.|. .:...:||.:.::.|::..|.||||.||.:..|.|  :.|.:
  Fly   319 ELARNQDVQDKLREEIGNVFGK-HNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTR--MTDTD 380

  Fly   396 INGK----LIPAGTNIGISPLYLGRREELFSEPNIFKPERFDVVTTAEKL--NP-YAYIPFSAGP 453
            .:.:    .|..||.:.|..|.:....:::.||.|||||||    |.|::  .| ..::||..||
  Fly   381 FSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERF----TDEEIAARPSCTWLPFGEGP 441

  Fly   454 RNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTKE 501
            |||||.:|.|::....:|.::|.|:.....::..|..::.:.||.:.|
  Fly   442 RNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILISAE 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 117/438 (27%)
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 114/425 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.