DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d1 and Cyp313a1

DIOPT Version :9

Sequence 1:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster


Alignment Length:509 Identity:128/509 - (25%)
Similarity:227/509 - (44%) Gaps:81/509 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVIGAILA-SALFVGLLLYHL-KFKRLIDLISYMPGPPVLPLVGHGHHFIGKPPHEMVKKIFEFM 65
            |.|..:|| .|||   .:|.| ..:||..|:..:|||..||::|.....|     ...|:...|.
  Fly     2 LTINLLLAVGALF---WIYFLWSRRRLYFLMLKIPGPIGLPILGSSLENI-----ITYKRKLSFR 58

  Fly    66 ETY--SKDQVLKVWLGPELNVLMGNPKDVEVVLGTLRFNDKAGE-YKALEPWLKEGLLVSRGRKW 127
            ..|  .....:..|:||...::..:||.||.:..:...::|:.. ..|:...:..|||..:...|
  Fly    59 TKYLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHW 123

  Fly   128 HKRRKIITPAFHFKILDQFVEVFEKGSRDLLRNMEQDRLKHGDSGF--SLYDWINLCTMDTICET 190
            ..|||...|:|...:|..|..:|:..:: :|.|:....:..|:...  .:..|    :.....:|
  Fly   124 LDRRKHFNPSFKQDLLLSFFHIFDAETK-VLMNLLDTYVDKGEIDVVPEMLRW----SFKIAAQT 183

  Fly   191 AMGVSINAQSN-ADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPL-----------ARAEKK 243
            .||..:....: .:...|::.:  |::.|..: |||.......|::.:           :|.:|.
  Fly   184 TMGSEVKHDEHFKNGSLVESFE--SLISHSTL-NILMPLVQNRMISKICGYDKLRADNFSRIQKM 245

  Fly   244 ALNVLHQFT-----------EKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVD 297
            ..||:::..           ..|::.|..||.|:|.                             
  Fly   246 LDNVVNKKVNPLPKTDSDPESNIVINRAMELYRKGD----------------------------- 281

  Fly   298 ERPLSNLDIREEVDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSYEL 362
               ::.:|::.|....:..|:||::..:....:.:|.|||.|:..|||:..|..:.....::|..
  Fly   282 ---ITYMDVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPD 343

  Fly   363 LNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEI-NGKLIPAGTNIGISPLYLGRREELFS-EPN 425
            :.:|.|::..:|||||:.|::|:..|:...|..: ||.|||.|..|||...:..|..|::. :.:
  Fly   344 MQKLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDAD 408

  Fly   426 IFKPERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEV 479
            .|.|:.| :....|:.:|||||||:.|.|||||.|:||:..|..:..:||:|::
  Fly   409 NFNPDNF-LAENMEQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKI 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 116/475 (24%)
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 116/475 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
54.860

Return to query results.
Submit another query.