DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d1 and CYP4B1

DIOPT Version :9

Sequence 1:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001093242.1 Gene:CYP4B1 / 1580 HGNCID:2644 Length:512 Species:Homo sapiens


Alignment Length:534 Identity:172/534 - (32%)
Similarity:271/534 - (50%) Gaps:91/534 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVIGAILASALFVGLLLYHLKFKR--LIDLISYMPGPPVLPLVGHGHHFIGKPPHEMVKKIFE 63
            :.||:|.         |.|.||..:|  |...:...||||...|.||.               .|
Human    20 LILVLGF---------LKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHA---------------LE 60

  Fly    64 FMETYSKDQVLK----------VWLGPELNVL-------------MGNPKDVEVVLGTLRFNDKA 105
            ..||.|.|:|:.          :|.|..:..|             .|:||..:|           
Human    61 IQETGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDV----------- 114

  Fly   106 GEYKALEPWLKEGLLVSRGRKWHKRRKIITPAFHFKILDQFVEVFEKGSRDLLRNMEQDRLKHGD 170
              |.....|:..||||..|.||.:.||::||.||:.:|..:|.||.:.:|.:|...| ::.:.|.
Human   115 --YDFFLQWIGRGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAVFTESTRIMLDKWE-EKAREGK 176

  Fly   171 SGFSLYDWINLCTMDTI--C-----ETAMGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYRF 228
            | |.::..:....::|:  |     :|.:|.|      .||.|..||..:::::.:|:.:..|..
Human   177 S-FDIFCDVGHMALNTLMKCTFGRGDTGLGHS------RDSSYYLAVSDLTLLMQQRLVSFQYHN 234

  Fly   229 DLTYMLTPLARAEKKALNVLHQFTEKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQ 293
            |..|.|||..|...:|..|.|..|:::|.:|:..|..|...::..|       :|.:.||||||.
Human   235 DFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQN-------RRHLDFLDILLG 292

  Fly   294 S-TVDERPLSNLDIREEVDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTP 357
            : ..|:..||:.|:|.|||||||||||||:|.:.:|.|.:|.:||.|.:|.||:|.::|:...  
Human   293 ARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDF-- 355

  Fly   358 VSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCE-INGKLIPAGTNIGISPLYLGRREELF 421
            ..::.|.::.|:.:|:||:.|:||.||.:.|::.:... ::|:.:|||:.|.:....|.|...::
Human   356 FQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVW 420

  Fly   422 SEPNIFKPERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSS 486
            .:|.:|...||. ...|.|.:|:|::||||||||||||:|||.|:|.:.|..|..:|  |..|.|
Human   421 PDPEVFDSLRFS-TENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFE--FSLDPS 482

  Fly   487 EPPVLIAELILRTK 500
            ..|:.:.:|:||:|
Human   483 RLPIKMPQLVLRSK 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 163/498 (33%)
CYP4B1NP_001093242.1 p450 47..501 CDD:306555 163/498 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.