DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wapl and AT1G11060

DIOPT Version :9

Sequence 1:NP_001284804.1 Gene:wapl / 31187 FlyBaseID:FBgn0004655 Length:1741 Species:Drosophila melanogaster
Sequence 2:NP_172573.2 Gene:AT1G11060 / 837647 AraportID:AT1G11060 Length:930 Species:Arabidopsis thaliana


Alignment Length:437 Identity:100/437 - (22%)
Similarity:169/437 - (38%) Gaps:101/437 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1083 KQGVPAT---------------STSSDAFDLDLEPIAGELDLERSAAGASA--GGTGATTGGGGA 1130
            |.|:|.|               |:||..   |:|||...| |..|:..:|:  ..:..:......
plant    67 KPGIPRTLSDSLNDSVSQTEYLSSSSSP---DIEPIDYSL-LPFSSQESSSLWHSSSRSNFREDY 127

  Fly  1131 TGGGGPVRVDRKTKDYYPVVRNVKTAHQIQEIGEYQEMDDDVEYILDALQPHNPPATRCLSALQL 1195
            ...||.||..::.::.........|..:.||.||..|.:|:|.:.||.|:..:....|..|...|
plant   128 PQNGGVVRRAKRVRNGAEAAAFTSTLLEAQEFGELMEHEDEVNFALDGLRKGHQLRIRRASLSSL 192

  Fly  1196 AAKCMMPAFRMHVRAHGVVTKFFKALSDAN-KDLSLGLCTSAIMYILSQEGLN---MDLDRDSLE 1256
            .:.|.....|..:||.|:......|:...: .|:...|..:.:.:.|:.:|.:   |:..: .::
plant   193 LSICASQHQRRSLRAQGISQSIIDAILVLSLDDIPSNLAAATLFFALTADGQDEHFMESPK-CIK 256

  Fly  1257 LMINLLEADGVGGSTETGHPDRAGY-------------------DRNKQKVRELCEEIKAQGKGT 1302
            .:|.||: ..:..||| |.|...|:                   |.:...:....:|:....|..
plant   257 FLIKLLK-PVIVTSTE-GKPRNIGFKLLSLLKDVDAARDPVKMDDPSSSDILSRVQELLVNCKEM 319

  Fly  1303 HLNVDSLT-----------VGTLAMETL---------LSLTSKRAGEWFKEDLRKLGGLEHIIKT 1347
            .||...:|           |..||||..         .|.:.|:.|..|||.||:||||:.:::.
plant   320 RLNDSYITETTRPELSTKWVALLAMERACVSKISFDDTSGSVKKTGGNFKEKLRELGGLDAVLEV 384

  Fly  1348 ISDFCRPVIACDTEIDWQPT--LLDN-----MQTVARCLRVLENVTQHNETNQRYMLTSGQGKAV 1405
            :.| |..|:....|.|....  ..||     :..:.:||:::||.|..:..||.::|.       
plant   385 VMD-CHAVMERWVEYDALSVQEKKDNLHKQSLMLLLKCLKIMENATFLSTDNQNHLLG------- 441

  Fly  1406 ETLCQLYRLCSRQIMLHPSDGGGSNKEHPGVAMRELLVPVLKVLINL 1452
                  ::.|.           ||:...  ::..||.:.|:|:|..|
plant   442 ------FKKCL-----------GSHDSR--MSFTELTISVIKMLSGL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
waplNP_001284804.1 WAPL 1152..1515 CDD:285105 81/351 (23%)
AT1G11060NP_172573.2 WAPL 151..518 CDD:400254 81/349 (23%)
WAPL <707..788 CDD:400254
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2152
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3015
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22100
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.