DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcn92 and ISD11

DIOPT Version :9

Sequence 1:NP_477059.2 Gene:bcn92 / 31186 FlyBaseID:FBgn0013432 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_010968.1 Gene:ISD11 / 856774 SGDID:S000007237 Length:94 Species:Saccharomyces cerevisiae


Alignment Length:80 Identity:28/80 - (35%)
Similarity:49/80 - (61%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TRRQAITLYRNLLRESEKLPSYNFRMYAARKIRDTFRANRSTRDFAEIDRQMAEGQQNLELIRRQ 67
            ||||.::||:..::.:.:..:||||.|...|.|.|||.|.:.:|...:.....|.:.:|.:::||
Yeast     8 TRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQ 72

  Fly    68 VIIGHLYSADKLVIE 82
            .:|..:|:.|:||:|
Yeast    73 SVISQMYTFDRLVVE 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcn92NP_477059.2 Complex1_LYR_1 5..65 CDD:289974 18/59 (31%)
ISD11NP_010968.1 Complex1_LYR_LYRM4 11..79 CDD:380759 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343646
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3801
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I1750
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54930
OrthoFinder 1 1.000 - - FOG0004084
OrthoInspector 1 1.000 - - oto99469
orthoMCL 1 0.900 - - OOG6_103491
Panther 1 1.100 - - LDO PTHR13166
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R619
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.