DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcn92 and CG42372

DIOPT Version :9

Sequence 1:NP_477059.2 Gene:bcn92 / 31186 FlyBaseID:FBgn0013432 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001137677.1 Gene:CG42372 / 7354379 FlyBaseID:FBgn0259718 Length:68 Species:Drosophila melanogaster


Alignment Length:62 Identity:19/62 - (30%)
Similarity:32/62 - (51%) Gaps:5/62 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TRRQAITLYRNLLRESE--KLPSYNFRMYAARKIRDTFRANRSTRDFAEIDRQMAEGQQNLE 62
            :|:|.:.||::|:|...  ||...|   |...::|..||.|||..:..|::.....|:..|:
  Fly     5 SRQQILRLYKHLIRYGNHLKLTDKN---YFLGRVRHEFRDNRSLTNPVEVEFSFKRGETLLK 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcn92NP_477059.2 Complex1_LYR_1 5..65 CDD:289974 18/60 (30%)
CG42372NP_001137677.1 Complex1_LYR 7..63 CDD:283097 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.