powered by:
Protein Alignment bcn92 and CG42372
DIOPT Version :9
Sequence 1: | NP_477059.2 |
Gene: | bcn92 / 31186 |
FlyBaseID: | FBgn0013432 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001137677.1 |
Gene: | CG42372 / 7354379 |
FlyBaseID: | FBgn0259718 |
Length: | 68 |
Species: | Drosophila melanogaster |
Alignment Length: | 62 |
Identity: | 19/62 - (30%) |
Similarity: | 32/62 - (51%) |
Gaps: | 5/62 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 TRRQAITLYRNLLRESE--KLPSYNFRMYAARKIRDTFRANRSTRDFAEIDRQMAEGQQNLE 62
:|:|.:.||::|:|... ||...| |...::|..||.|||..:..|::.....|:..|:
Fly 5 SRQQILRLYKHLIRYGNHLKLTDKN---YFLGRVRHEFRDNRSLTNPVEVEFSFKRGETLLK 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.