DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcn92 and LYRM4

DIOPT Version :9

Sequence 1:NP_477059.2 Gene:bcn92 / 31186 FlyBaseID:FBgn0013432 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001158312.1 Gene:LYRM4 / 57128 HGNCID:21365 Length:130 Species:Homo sapiens


Alignment Length:67 Identity:30/67 - (44%)
Similarity:49/67 - (73%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STRRQAITLYRNLLRESEKLPSYNFRMYAARKIRDTFRANRSTRDFAEIDRQMAEGQQNLELIRR 66
            |:|.|.::|||.:||||::..:||:|.||.|:|||.||.|::.:|..||...:.:.:::|.:|||
Human     4 SSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRR 68

  Fly    67 QV 68
            |:
Human    69 QM 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcn92NP_477059.2 Complex1_LYR_1 5..65 CDD:289974 24/59 (41%)
LYRM4NP_001158312.1 Complex1_LYR_1 7..67 CDD:289974 24/59 (41%)
GVQW 75..122 CDD:290611
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I11052
eggNOG 1 0.900 - - E1_KOG3801
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I5118
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54930
OrthoDB 1 1.010 - - D1561410at2759
OrthoFinder 1 1.000 - - FOG0004084
OrthoInspector 1 1.000 - - oto89597
orthoMCL 1 0.900 - - OOG6_103491
Panther 1 1.100 - - LDO PTHR13166
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R619
SonicParanoid 1 1.000 - - X3358
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.