Sequence 1: | NP_477059.2 | Gene: | bcn92 / 31186 | FlyBaseID: | FBgn0013432 | Length: | 92 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001158312.1 | Gene: | LYRM4 / 57128 | HGNCID: | 21365 | Length: | 130 | Species: | Homo sapiens |
Alignment Length: | 67 | Identity: | 30/67 - (44%) |
---|---|---|---|
Similarity: | 49/67 - (73%) | Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 STRRQAITLYRNLLRESEKLPSYNFRMYAARKIRDTFRANRSTRDFAEIDRQMAEGQQNLELIRR 66
Fly 67 QV 68 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bcn92 | NP_477059.2 | Complex1_LYR_1 | 5..65 | CDD:289974 | 24/59 (41%) |
LYRM4 | NP_001158312.1 | Complex1_LYR_1 | 7..67 | CDD:289974 | 24/59 (41%) |
GVQW | 75..122 | CDD:290611 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 56 | 1.000 | Domainoid score | I11052 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3801 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 90 | 1.000 | Inparanoid score | I5118 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG54930 | |
OrthoDB | 1 | 1.010 | - | - | D1561410at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0004084 | |
OrthoInspector | 1 | 1.000 | - | - | oto89597 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_103491 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR13166 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R619 |
SonicParanoid | 1 | 1.000 | - | - | X3358 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
14 | 13.870 |