DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcn92 and LOC103909737

DIOPT Version :9

Sequence 1:NP_477059.2 Gene:bcn92 / 31186 FlyBaseID:FBgn0013432 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001373546.1 Gene:LOC103909737 / 103909737 -ID:- Length:91 Species:Danio rerio


Alignment Length:84 Identity:37/84 - (44%)
Similarity:58/84 - (69%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STRRQAITLYRNLLRESEKLPSYNFRMYAARKIRDTFRANRSTRDFAEIDRQMAEGQQNLELIRR 66
            |:|...:::||.||:||:|.||||:|.||.|::||.||.||:..|...::..:...::||.:|:|
Zfish     4 SSREHVLSVYRLLLKESKKFPSYNYRTYALRRVRDAFRENRTVEDPQRVEELLNRARENLAIIQR 68

  Fly    67 QVIIGHLYSADKLVIENKK 85
            ||.:|.:|.|.|.|:|.:|
Zfish    69 QVCVGQMYEAQKTVVEQEK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcn92NP_477059.2 Complex1_LYR_1 5..65 CDD:289974 24/59 (41%)
LOC103909737NP_001373546.1 Complex1_LYR_LYRM4 8..76 CDD:380759 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10750
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5138
OMA 1 1.010 - - QHG54930
OrthoDB 1 1.010 - - D1561410at2759
OrthoFinder 1 1.000 - - FOG0004084
OrthoInspector 1 1.000 - - otm25201
orthoMCL 1 0.900 - - OOG6_103491
Panther 1 1.100 - - LDO PTHR13166
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3358
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.