DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcn92 and Lyrm4

DIOPT Version :9

Sequence 1:NP_477059.2 Gene:bcn92 / 31186 FlyBaseID:FBgn0013432 Length:92 Species:Drosophila melanogaster
Sequence 2:XP_006253921.1 Gene:Lyrm4 / 102550385 RGDID:7672286 Length:91 Species:Rattus norvegicus


Alignment Length:84 Identity:43/84 - (51%)
Similarity:64/84 - (76%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STRRQAITLYRNLLRESEKLPSYNFRMYAARKIRDTFRANRSTRDFAEIDRQMAEGQQNLELIRR 66
            |:|.|.:.|||.::|||:...:||:||||.|:|||.||.|::.:|..||...:.:.:::||:|||
  Rat     4 SSRAQVLDLYRAMMRESKHFSAYNYRMYAVRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRR 68

  Fly    67 QVIIGHLYSADKLVIENKK 85
            ||:||.|||.|||:|||::
  Rat    69 QVLIGQLYSTDKLIIENQE 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcn92NP_477059.2 Complex1_LYR_1 5..65 CDD:289974 25/59 (42%)
Lyrm4XP_006253921.1 Complex1_LYR_1 7..67 CDD:289974 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10554
eggNOG 1 0.900 - - E1_KOG3801
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I4966
OMA 1 1.010 - - QHG54930
OrthoDB 1 1.010 - - D1561410at2759
OrthoFinder 1 1.000 - - FOG0004084
OrthoInspector 1 1.000 - - oto96714
orthoMCL 1 0.900 - - OOG6_103491
Panther 1 1.100 - - LDO PTHR13166
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3358
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.