DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcn92 and lyrm4

DIOPT Version :9

Sequence 1:NP_477059.2 Gene:bcn92 / 31186 FlyBaseID:FBgn0013432 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001185822.1 Gene:lyrm4 / 100379678 XenbaseID:XB-GENE-944549 Length:89 Species:Xenopus tropicalis


Alignment Length:84 Identity:39/84 - (46%)
Similarity:60/84 - (71%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STRRQAITLYRNLLRESEKLPSYNFRMYAARKIRDTFRANRSTRDFAEIDRQMAEGQQNLELIRR 66
            |:|.|.::||:.:||||::..|||:|.||.|:|||.||..::..||.||:..:...::||.:|:|
 Frog     4 SSRSQVLSLYKIMLRESQRFNSYNYRTYAIRRIRDAFREKKNVDDFHEIETLLHRAKENLSVIQR 68

  Fly    67 QVIIGHLYSADKLVIENKK 85
            ||.||.:|:..|||||:.:
 Frog    69 QVTIGQMYATQKLVIESSE 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcn92NP_477059.2 Complex1_LYR_1 5..65 CDD:289974 25/59 (42%)
lyrm4NP_001185822.1 Complex1_LYR_LYRM4 8..76 CDD:380759 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10648
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5166
OMA 1 1.010 - - QHG54930
OrthoDB 1 1.010 - - D1561410at2759
OrthoFinder 1 1.000 - - FOG0004084
OrthoInspector 1 1.000 - - oto103422
Panther 1 1.100 - - LDO PTHR13166
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3358
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.