DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcn92 and lyrm4

DIOPT Version :9

Sequence 1:NP_477059.2 Gene:bcn92 / 31186 FlyBaseID:FBgn0013432 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001157713.1 Gene:lyrm4 / 100302660 ZFINID:ZDB-GENE-081104-295 Length:89 Species:Danio rerio


Alignment Length:85 Identity:39/85 - (45%)
Similarity:59/85 - (69%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TRRQAITLYRNLLRESEKLPSYNFRMYAARKIRDTFRANRSTRDFAEIDRQMAEGQQNLELIRRQ 67
            :|.|.|:|||.|::||:|.||||:|.||.|:::|.||.|....:...:|..:.:.::||.:|:||
Zfish     5 SRAQVISLYRMLMKESKKFPSYNYRTYALRRVKDGFRENLHVDNPRTLDLLINQARENLAVIKRQ 69

  Fly    68 VIIGHLYSADKLVIENKKTL 87
            |.|||||||.:.|:|.:..|
Zfish    70 VSIGHLYSAQRTVVEKEPHL 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcn92NP_477059.2 Complex1_LYR_1 5..65 CDD:289974 24/59 (41%)
lyrm4NP_001157713.1 Complex1_LYR_1 7..67 CDD:289974 24/59 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10750
eggNOG 1 0.900 - - E1_KOG3801
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5138
OMA 1 1.010 - - QHG54930
OrthoDB 1 1.010 - - D1561410at2759
OrthoFinder 1 1.000 - - FOG0004084
OrthoInspector 1 1.000 - - otm25201
orthoMCL 1 0.900 - - OOG6_103491
Panther 1 1.100 - - O PTHR13166
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R619
SonicParanoid 1 1.000 - - X3358
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.