DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urm1 and Urm1

DIOPT Version :9

Sequence 1:NP_001131034.2 Gene:Urm1 / 311840 RGDID:1306599 Length:101 Species:Rattus norvegicus
Sequence 2:NP_996018.2 Gene:Urm1 / 2768949 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster


Alignment Length:102 Identity:64/102 - (62%)
Similarity:80/102 - (78%) Gaps:2/102 - (1%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MAAP-LCVEVEFGGGAELLFDGVKKHQVTLPGQEEPWDIRNLLVWIKTNLLKERPELFIQGDSVR 64
            |..| |.:.:||..||||||..:|:.::.|.|::: |.|.|||.|:..|:|.||||||:|||:||
  Fly     1 MGTPELKIILEFSAGAELLFGNIKRRELNLDGKQK-WTIANLLKWMHANILTERPELFLQGDTVR 64

  Rat    65 PGILVLINDADWELLGELDYQLQDQDSILFISTLHGG 101
            |||||||||.||||||||||:||..|::|||||||||
  Fly    65 PGILVLINDTDWELLGELDYELQPNDNVLFISTLHGG 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Urm1NP_001131034.2 Urm1 6..101 CDD:286251 59/94 (63%)
Urm1NP_996018.2 Urm1 7..101 CDD:286251 59/93 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350917
Domainoid 1 1.000 133 1.000 Domainoid score I4936
eggNOG 1 0.900 - - E1_COG5131
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41688
Inparanoid 1 1.050 133 1.000 Inparanoid score I4508
OMA 1 1.010 - - QHG53739
OrthoDB 1 1.010 - - D1541629at2759
OrthoFinder 1 1.000 - - FOG0004387
OrthoInspector 1 1.000 - - oto98038
orthoMCL 1 0.900 - - OOG6_102802
Panther 1 1.100 - - LDO PTHR14986
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3670
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.