DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D2hgdh and ALO1

DIOPT Version :9

Sequence 1:NP_569982.1 Gene:D2hgdh / 31184 FlyBaseID:FBgn0023507 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_013624.1 Gene:ALO1 / 854888 SGDID:S000004551 Length:526 Species:Saccharomyces cerevisiae


Alignment Length:221 Identity:48/221 - (21%)
Similarity:92/221 - (41%) Gaps:38/221 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KPGSTAEVAAILKYCN--ERRLAVVPQGGNTGLVGGSVPICDEIVLSLARLNKV--------LSV 173
            :|.|..||..::|...  |:.|..|..|.:.    .::.:.||.:::|.||:||        |..
Yeast    28 QPSSIDEVVELVKSARLAEKSLVTVGSGHSP----SNMCVTDEWLVNLDRLDKVQKFVEYPELHY 88

  Fly   174 DEVTGIAVVEAGCILENFDQRAREVGLTVPLDLGAKASCHIGGNVSTNAGGVRVVRYGNLHGSVL 238
            .:||    |:||..|...::.....|.::. :||:.:...:.|.:||.:.|.... :|.:....:
Yeast    89 ADVT----VDAGMRLYQLNEFLGAKGYSIQ-NLGSISEQSVAGIISTGSHGSSPY-HGLISSQYV 147

  Fly   239 GVEAVLATGQV--LDLMSNFKKDNTGYHMKHLFIGSEGTLGVVTKLSMLCPHSSRAVNVAFIGLN 301
            .:..|...|::  ||      .:|.....|...: |.|.:|::...::..        |....:.
Yeast   148 NLTIVNGKGELKFLD------AENDPEVFKAALL-SVGKIGIIVSATIRV--------VPGFNIK 197

  Fly   302 SFDDVLKTFVSAKRNLGEILSSCELI 327
            |..:|: ||.:..:....:.:|.|.|
Yeast   198 STQEVI-TFENLLKQWDTLWTSSEFI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D2hgdhNP_569982.1 GlcD 85..532 CDD:223354 48/221 (22%)
FAD_binding_4 115..252 CDD:279851 34/144 (24%)
FAD-oxidase_C 291..531 CDD:280983 8/37 (22%)
ALO1NP_013624.1 FAD_lactone_ox 9..509 CDD:273751 48/221 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.