DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D2hgdh and Dhcr24

DIOPT Version :9

Sequence 1:NP_569982.1 Gene:D2hgdh / 31184 FlyBaseID:FBgn0023507 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_444502.2 Gene:Dhcr24 / 74754 MGIID:1922004 Length:516 Species:Mus musculus


Alignment Length:410 Identity:79/410 - (19%)
Similarity:138/410 - (33%) Gaps:125/410 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LARLNKVLSVDEVTGIAVVEAGCILENFDQRAREVGLTVPL-----DL---------GAKASCHI 214
            :..|..:|.||....|..||....:.........:|.|:|:     ||         |.::|.| 
Mouse   115 MINLMDILEVDTKKQIVRVEPLVSMGQVTALLNSIGWTLPVLPELDDLTVGGLIMGTGIESSSH- 178

  Fly   215 GGNVSTNAGGVRVVRYGNLHGSVLGVEAVLATGQVLDLMSNFKKDNTGYHMKHLFIG---SEGTL 276
                          :||.........|.:||.|..:....:...|        ||..   |.|||
Mouse   179 --------------KYGLFQHICTAYELILADGSFVRCTPSENSD--------LFYAVPWSCGTL 221

  Fly   277 GVVTKLSMLCPHSSRAVNVAFIGLNSFDDVLKTFVSAKRNL------GEILSSCELIDERALNTA 335
            |.:....:....:.:.|.:.|..:...:.:.:.|....:.|      |.:.|    :||..:.|.
Mouse   222 GFLVAAEIRIIPAKKYVKLRFEPVRGLEAICEKFTRESQRLENHFVEGLLYS----LDEAVIMTG 282

  Fly   336 -----LEQFKFLNSPISGF-PFYMLIETSGSNGDHDEE--KINQFIGDGME----RGEIQDGTVT 388
                 :|..| |||..|.: |::.         .|.|.  |.|:   :|:|    |......|.:
Mouse   283 VMTDDVEPSK-LNSIGSYYKPWFF---------KHVENYLKTNR---EGLEYIPLRHYYHRHTRS 334

  Fly   389 GDPGKVQEIWKIREMVPLGLIEKSFCFKY--------DISL-------PLRDFYNIVDVMRERCG 438
                   ..|::::::|.|   .:..|:|        .|||       .||..|....|:::...
Mouse   335 -------IFWELQDIIPFG---NNPIFRYLFGWMVPPKISLLKLTQGETLRKLYEQHHVVQDMLV 389

  Fly   439 PLATVVCGYGHLGDSNLHLN---------------VSCEEFNGEIYKRV----EPFVYEYTSK-- 482
            |:..:.... |...:::|:.               |..:....|:|..:    ||.|..:.::  
Mouse   390 PMKCMSQAL-HTFQNDIHVYPIWLCPFILPSQPGLVHPKGDEAELYVDIGAYGEPRVKHFEARSC 453

  Fly   483 ---LKGSISAEHGIGFLKKD 499
               |:..:.:.||...|..|
Mouse   454 MRQLEKFVRSVHGFQMLYAD 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D2hgdhNP_569982.1 GlcD 85..532 CDD:223354 79/410 (19%)
FAD_binding_4 115..252 CDD:279851 21/101 (21%)
FAD-oxidase_C 291..531 CDD:280983 50/266 (19%)
Dhcr24NP_444502.2 GlcD 114..>270 CDD:223354 33/177 (19%)
FAD_binding_4 <114..203 CDD:279851 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.