DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D2hgdh and Gulo

DIOPT Version :9

Sequence 1:NP_569982.1 Gene:D2hgdh / 31184 FlyBaseID:FBgn0023507 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_071556.2 Gene:Gulo / 60671 RGDID:620701 Length:440 Species:Rattus norvegicus


Alignment Length:230 Identity:57/230 - (24%)
Similarity:99/230 - (43%) Gaps:36/230 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KPGSTAEVAAILKYCNERRLAVVPQGGNTGLVGGSVPICDEIVLSLARLNKVLSVDEVTGIAVVE 183
            :|.|..||..:|....|::..|...||  |.....:...|..::.:.::|:||.||:......||
  Rat    26 QPTSVEEVREVLALAREQKKKVKVVGG--GHSPSDIACTDGFMIHMGKMNRVLQVDKEKKQVTVE 88

  Fly   184 AGCILENFDQRAREVGLTVPLDLGAKASCHIGGNVST---NAGGVRVVRYGNLHGSVLGVEAVLA 245
            ||.:|.:...:..|.||.:. :|||.:...:.|.:.:   |.|    :::|.|...|:.:..:.|
  Rat    89 AGILLADLHPQLDEHGLAMS-NLGAVSDVTVAGVIGSGTHNTG----IKHGILATQVVALTLMTA 148

  Fly   246 TGQVLDLMSNFKKDNTGYHMKHLFIGSEGTLGVVTKLSMLCPHSSRAVNVAFIGLNSFDDVLKTF 310
            .|:||:...:...|.......||     |.||::..:::.|      |....:...||...||  
  Rat   149 DGEVLECSESRNADVFQAARVHL-----GCLGIILTVTLQC------VPQFHLQETSFPSTLK-- 200

  Fly   311 VSAKRNLGEILSSCELIDERALNTALEQFKFLNSP 345
                    |:|.:.:...:|:     |.|:||..|
  Rat   201 --------EVLDNLDSHLKRS-----EYFRFLWFP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D2hgdhNP_569982.1 GlcD 85..532 CDD:223354 57/230 (25%)
FAD_binding_4 115..252 CDD:279851 37/135 (27%)
FAD-oxidase_C 291..531 CDD:280983 13/55 (24%)
GuloNP_071556.2 FAD_lactone_ox 7..433 CDD:273751 57/230 (25%)
FAD_binding_4 21..156 CDD:279851 37/136 (27%)
ALO 180..438 CDD:281959 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.