DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D2hgdh and dhcr24

DIOPT Version :9

Sequence 1:NP_569982.1 Gene:D2hgdh / 31184 FlyBaseID:FBgn0023507 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001008645.1 Gene:dhcr24 / 494102 ZFINID:ZDB-GENE-041212-73 Length:516 Species:Danio rerio


Alignment Length:328 Identity:65/328 - (19%)
Similarity:107/328 - (32%) Gaps:132/328 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VLSLARLNKVLSVDEVTGIAVVEAGCILENFDQRAREVGLTVPL-----DL---------GAKAS 211
            :|.:....||:.|:.:..:..|.|   |.|      .:|.|:|:     ||         |.::|
Zfish   121 ILEVDTKRKVVRVEPLANMGQVTA---LLN------SIGWTLPVLPELDDLTVGGLVMGTGIESS 176

  Fly   212 CHIGGNVSTNAGGVRVVRYGNLHGSVLGVEAVLATGQVLDLMSNFKKDNTGYHMKHLFIG---SE 273
            .||               ||......:..|.|||.|   .|:...:|:|:     .||..   |.
Zfish   177 SHI---------------YGLFQHICVAFELVLADG---SLVRCTEKENS-----DLFYAVPWSC 218

  Fly   274 GTLGVVTKLSMLCPHSSRAVNVAFIGLNSFDDVLKTFVSAKRNLGEILSSCELIDERALNTALEQ 338
            ||||.:....:....:.:.|.:.:..:...|.:.|.|.....|                      
Zfish   219 GTLGFLVAAEIRIIPAQKWVKLHYEPVRGLDAICKKFAEESAN---------------------- 261

  Fly   339 FKFLNSPISGFPFYMLIETSGSNGDHDEEKINQFIGDGME--RGE--IQDGTVT--GDPGKVQEI 397
                                         |.|||: :|::  |.|  |..|.:|  .:|.|...|
Zfish   262 -----------------------------KENQFV-EGLQYSRDEAVIMTGVMTDHAEPDKTNCI 296

  Fly   398 ------WKIREMVPLGLIEKSFCFKYDIS---LPLRDFYN---------IVDVMRERCGPLATVV 444
                  |..|.:       :||..:..::   :|||.:|:         :.|::.....||...|
Zfish   297 GYYYKPWFFRHV-------ESFLKQNRVAVEYIPLRHYYHRHTRSIFWELQDIIPFGNNPLFRYV 354

  Fly   445 CGY 447
            .|:
Zfish   355 FGW 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D2hgdhNP_569982.1 GlcD 85..532 CDD:223354 65/328 (20%)
FAD_binding_4 115..252 CDD:279851 24/104 (23%)
FAD-oxidase_C 291..531 CDD:280983 31/181 (17%)
dhcr24NP_001008645.1 FAD_binding_4 <114..203 CDD:279851 25/108 (23%)
GlcD 118..503 CDD:223354 65/328 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.