DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D2hgdh and agps

DIOPT Version :9

Sequence 1:NP_569982.1 Gene:D2hgdh / 31184 FlyBaseID:FBgn0023507 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_956407.1 Gene:agps / 386801 ZFINID:ZDB-GENE-031118-14 Length:629 Species:Danio rerio


Alignment Length:559 Identity:129/559 - (23%)
Similarity:227/559 - (40%) Gaps:119/559 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GAPIPELTEITDNVQRGNYATLTDKDV--AHFEQLLGKNFVLTEDLEG----------YNICFLK 108
            ||.:...:..|.::   |.:.::..::  |..|.|.....:.:.|.|.          :.|..|:
Zfish   108 GASLQHKSPATSSL---NVSAVSPPNLNEAFSEDLKAAGLLASHDAEDRVFRAHGHCLHEIFALR 169

  Fly   109 --RIRGNSKLVLKPGSTAEVAAILKYCNERRLAVVPQGGNTGLVGGSVPICDE------IVLSLA 165
              ||.....:|:.|...::|..|:....:..:.::|.||.|.:  .|...|.:      :.|..:
Zfish   170 EGRIGRVPDMVVWPSCHSDVEKIVDLACKHNVCLIPYGGGTSV--SSALECPQEETRCIVSLDTS 232

  Fly   166 RLNKVLSVDEVTGIAVVEAGCILENFDQRAREVGLTVPLDLGAKASCHIGGNVSTNAGGVRVVRY 230
            ::|::|.:||....|.||||.|.::.:::..|.|.....:..:.....:||.|:|.|.|::...|
Zfish   233 QMNRILWIDEKNLTAHVEAGIIGQDLERQLNERGYCTGHEPDSMEFSSLGGWVATRASGMKKNIY 297

  Fly   231 GNLHGSVLGVEAVLATGQVLDLMSNFKKDNTGYHMKHLFIGSEGTLGVVTKLSML---CPHSSRA 292
            ||:...|:.::.|...| |::......:.:||..:.|..:||||||||||:::|.   .|...:.
Zfish   298 GNIEDLVVHIKMVTPRG-VIEKSCLGPRMSTGPDIHHFIMGSEGTLGVVTEVTMKIRPIPEYQKY 361

  Fly   293 VNVAFIGLNSFDDVLKTFVSAKRNLGEIL------SSCELIDERALNTALEQF------------ 339
            .:|.|          ..|......|.|:.      :|..|:|.       |||            
Zfish   362 GSVVF----------PNFQQGVACLREVARQRCAPASIRLMDN-------EQFQFGHALKPQVSS 409

  Fly   340 ----------KFLNSPISGF-PFYMLIETSGSNGDH----DEEKINQFIGDGMERGEIQDGTVTG 389
                      ||..:...|| |.::.:.|....||.    ..||  |......:.|.:..|...|
Zfish   410 IFTSFLDGLKKFYITKFKGFDPHHLCVATLLFEGDRGKVLQHEK--QVYDIAAKFGGLAAGEDNG 472

  Fly   390 DPGKVQEIWKIREMVPLGL----IEKSFCFKYDISLPLRDFYNIVDVMRER----C-------GP 439
            ..|.:. .:.|..:..||:    |::||    :.|:|.....::...::||    |       .|
Zfish   473 QRGYML-TFVIAYLRDLGMDYYVIDESF----ETSVPWDRVLDLCRNVKERIIRECKERGVQFPP 532

  Fly   440 LATVVCGYGHLGDSNLHLNVSCEEF------NG-----EIYKRVEPFVYEYTSKLKGSISAEHGI 493
            |:|  |......|:.     :|..|      .|     .:|::||....|......||:|..||:
Zfish   533 LST--CRVTQTYDAG-----ACVYFYFAFNYRGLSDPVHVYEQVEHAAREEILANGGSLSHHHGV 590

  Fly   494 GFLKKDYLHYSKDPVAIGYMREMKKLLDPNSILNPYKVL 532
            |.|:|:::..|...|.:|.::.:|:.:||.:|.....:|
Zfish   591 GKLRKEWMKESVSGVGLGMIQSVKEFVDPQNIFGSRNLL 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D2hgdhNP_569982.1 GlcD 85..532 CDD:223354 123/526 (23%)
FAD_binding_4 115..252 CDD:279851 36/142 (25%)
FAD-oxidase_C 291..531 CDD:280983 64/298 (21%)
agpsNP_956407.1 GlcD 175..623 CDD:223354 114/481 (24%)
FAD_binding_4 177..318 CDD:279851 36/143 (25%)
FAD-oxidase_C 355..628 CDD:280983 65/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.