DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D2hgdh and Ldhd

DIOPT Version :9

Sequence 1:NP_569982.1 Gene:D2hgdh / 31184 FlyBaseID:FBgn0023507 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001008893.1 Gene:Ldhd / 307858 RGDID:1308107 Length:501 Species:Rattus norvegicus


Alignment Length:430 Identity:113/430 - (26%)
Similarity:187/430 - (43%) Gaps:80/430 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VLKPGSTAEVAAILKYCNERRLAVVPQGGNTGLVGGSVPICDEIVLSLARLNKVLSVDEVTGIAV 181
            |:.|.:..:|:.:...|..:.:.::|.|..||:.||...:...:.:||..:::::.::......|
  Rat    81 VVWPQNVDQVSRLASLCYNQGVPIIPFGTGTGVEGGVCAVQGGVCISLTHMDQIMELNTEDFSVV 145

  Fly   182 VEAGCILENFDQRAREVGLTVPLDLGAKASCHIGGNVSTNAGGVRVVRYGNLHGSVLGVEAVLAT 246
            ||.|...:..:...|..||..|:|.||.||  :.|..:|.|.|...||||.:..:|:.:|.||..
  Rat   146 VEPGVTRKALNTHLRNSGLWFPVDPGADAS--LCGMAATGASGTNAVRYGTMRDNVINLEVVLPD 208

  Fly   247 GQVLDLMS---NFKKDNTGYHMKHLFIGSEGTLGVVTKLSML---CPHSSRAVNVAF----IGLN 301
            |::|....   :::|...||::..||:|||||||::|..::.   .|.::.|...||    ..::
  Rat   209 GRLLHTAGRGRHYRKSAAGYNLTGLFVGSEGTLGIITSATLRLHPAPEATVAATCAFPSVQAAVD 273

  Fly   302 SFDDVLKTFVSAKRNLGEILSSCELIDERALNTALEQFKFLNSPISGFPFYMLIETSGSNGDHDE 366
            |...:|:..|...|        .|.:|| .:..|..:...||.|::...|   :|..||      
  Rat   274 STVQILQAAVPVAR--------IEFLDE-VMMDACNRHSKLNCPVAPTLF---LEFHGS------ 320

  Fly   367 EKINQFIGDGMERGEIQDGTVTGDPG-----------KVQEIWKIREMVPLGLIEKSFCFKYDIS 420
               .|.:.:.::|.|    .:|.|.|           |..|:|..|...            :..:
  Rat   321 ---QQALAEQLQRTE----AITQDNGGSHFSWAKEAEKRNELWAARHNA------------WYAA 366

  Fly   421 LPLRDFYNIVDVMRERCGPLATVVCGYGHLGDSNLHLNVSCEEFNGEIYKRVEPFVYEYTSK--- 482
            |.||              |...:|   ||:||.|.|..:.....:.|..:||:.|......:   
  Rat   367 LALR--------------PGRVIV---GHVGDGNFHCILLVNPDDVEEQRRVKAFAENLGRRALA 414

  Fly   483 LKGSISAEHGIGFLKKDYLHYSKDPVAIGYMREMKKLLDP 522
            |.|:.:.|||||..|:..|.....||.:..||::|..|||
  Rat   415 LHGTCTGEHGIGLGKRQLLQEEVGPVGVETMRQLKDTLDP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D2hgdhNP_569982.1 GlcD 85..532 CDD:223354 113/430 (26%)
FAD_binding_4 115..252 CDD:279851 39/134 (29%)
FAD-oxidase_C 291..531 CDD:280983 60/250 (24%)
LdhdNP_001008893.1 GlcD 46..454 CDD:223354 111/428 (26%)
FAD_binding_4 78..214 CDD:279851 39/134 (29%)
FAD-oxidase_C 255..455 CDD:280983 61/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D216115at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100306
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.