DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D2hgdh and LDHD

DIOPT Version :9

Sequence 1:NP_569982.1 Gene:D2hgdh / 31184 FlyBaseID:FBgn0023507 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_024305942.1 Gene:LDHD / 197257 HGNCID:19708 Length:567 Species:Homo sapiens


Alignment Length:500 Identity:121/500 - (24%)
Similarity:194/500 - (38%) Gaps:136/500 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 STAEVAAILKYCNERRLAVVPQGGNTGLVGGSVPICDEIVLSLARLNKVLSVDEVTGIAVVEAGC 186
            |..:|.:.|..|..       |||          :|    ::|..::::|.:::.....|||.|.
Human   115 SETQVCSGLSTCPN-------QGG----------VC----VNLTHMDRILELNQEDFSVVVEPGV 158

  Fly   187 ILENFDQRAREVGLTVPLDLGAKASCHIGGNVSTNAGGVRVVRYGNLHGSVLGVEAVLATGQVLD 251
            ..:..:...|:.||..|:|.||.||  :.|..:|.|.|...||||.:..:||.:|.||..|::|.
Human   159 TRKALNAHLRDSGLWFPVDPGADAS--LCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLH 221

  Fly   252 LMS---NF-----------------------KKDNTGYHMKHLFIGSEGTLGVVTKLSML---CP 287
            ...   :|                       :|...||::..||:|||||||::|..::.   .|
Human   222 TAGRGRHFRFGFWPEIPHHTAWYSPCVSLGRRKSAAGYNLTGLFVGSEGTLGLITATTLRLHPAP 286

  Fly   288 HSSRAVNVAFIGLNSFDD----VLKTFVSAKRNLGEILSSCELIDERALNTALEQFKFLNSPISG 348
            .::.|...||..:.:..|    :|:..|...|        .|.:|| .:..|..::..||..::.
Human   287 EATVAATCAFPSVQAAVDSTVHILQAAVPVAR--------IEFLDE-VMMDACNRYSKLNCLVAP 342

  Fly   349 FPFYMLIETSGSNGDHDEEKINQFIGDGMERGE---IQDGTVTGDPGKVQE----IWKIREMV-P 405
            ..|   :|..||         .|.:.:.::|.|   .|:|.......|..|    :|..|... .
Human   343 TLF---LEFHGS---------QQALEEQLQRTEEIVQQNGASDFSWAKEAEERSRLWTARHNAWY 395

  Fly   406 LGLIEKSFCFKY--DISLPLRDFYNIVDVMRE--------------------------------- 435
            ..|..:..|..|  |:.:|:.....||...:|                                 
Human   396 AALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSAHPAAGERWGGVRADQSLGQQEA 460

  Fly   436 ----------RCGPLATVVCGYGHLGDSNLHLNVSCEEFNGEIYKRVEPFVYEYTSK---LKGSI 487
                      ..||..::|   ||:||.|.|..:.....:.|...||:.|..:...:   |.|:.
Human   461 RGGLGWRIVLSSGPPGSIV---GHVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTC 522

  Fly   488 SAEHGIGFLKKDYLHYSKDPVAIGYMREMKKLLDPNSILNPYKVL 532
            :.|||||..|:..|......|.:..||::|.:|||..::||.|||
Human   523 TGEHGIGMGKRQLLQEEVGAVGVETMRQLKAVLDPQGLMNPGKVL 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D2hgdhNP_569982.1 GlcD 85..532 CDD:223354 119/498 (24%)
FAD_binding_4 115..252 CDD:279851 38/129 (29%)
FAD-oxidase_C 291..531 CDD:280983 65/299 (22%)
LDHDXP_024305942.1 FAD-oxidase_C <125..567 CDD:332893 116/488 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1267
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D216115at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100306
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.670

Return to query results.
Submit another query.