DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D2hgdh and DHCR24

DIOPT Version :9

Sequence 1:NP_569982.1 Gene:D2hgdh / 31184 FlyBaseID:FBgn0023507 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_055577.1 Gene:DHCR24 / 1718 HGNCID:2859 Length:516 Species:Homo sapiens


Alignment Length:410 Identity:79/410 - (19%)
Similarity:137/410 - (33%) Gaps:125/410 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LARLNKVLSVDEVTGIAVVEAGCILENFDQRAREVGLTVPL-----DL---------GAKASCHI 214
            :..|..:|.||....|..||....:.........:|.|:|:     ||         |.::|.| 
Human   115 MINLMDILEVDTKKQIVRVEPLVTMGQVTALLTSIGWTLPVLPELDDLTVGGLIMGTGIESSSH- 178

  Fly   215 GGNVSTNAGGVRVVRYGNLHGSVLGVEAVLATGQVLDLMSNFKKDNTGYHMKHLFIG---SEGTL 276
                          :||.........|.|||.|..:....:...|        ||..   |.|||
Human   179 --------------KYGLFQHICTAYELVLADGSFVRCTPSENSD--------LFYAVPWSCGTL 221

  Fly   277 GVVTKLSMLCPHSSRAVNVAFIGLNSFDDVLKTFVSAKRN-----LGEILSSCELIDERALNTAL 336
            |.:....:....:.:.|.:.|..:...:.:...|....:.     :..:|.|   :||..:.|.:
Human   222 GFLVAAEIRIIPAKKYVKLRFEPVRGLEAICAKFTHESQRQENHFVEGLLYS---LDEAVIMTGV 283

  Fly   337 -----EQFKFLNSPISGF--PFYMLIETSGSNGDHDEE--KINQFIGDGME----RGEIQDGTVT 388
                 |..| ||| |..:  |::.         .|.|.  |.|:   :|:|    |......|.:
Human   284 MTDEAEPSK-LNS-IGNYYKPWFF---------KHVENYLKTNR---EGLEYIPLRHYYHRHTRS 334

  Fly   389 GDPGKVQEIWKIREMVPLGLIEKSFCFKY--------DISL-------PLRDFYNIVDVMRERCG 438
                   ..|::::::|.|   .:..|:|        .|||       .||..|....|:::...
Human   335 -------IFWELQDIIPFG---NNPIFRYLFGWMVPPKISLLKLTQGETLRKLYEQHHVVQDMLV 389

  Fly   439 PLATVVCGYGHLGDSNLHLN---------------VSCEEFNGEIYKRV----EPFVYEYTSK-- 482
            |:..:.... |...:::|:.               |..:....|:|..:    ||.|..:.::  
Human   390 PMKCLQQAL-HTFQNDIHVYPIWLCPFILPSQPGLVHPKGNEAELYIDIGAYGEPRVKHFEARSC 453

  Fly   483 ---LKGSISAEHGIGFLKKD 499
               |:..:.:.||...|..|
Human   454 MRQLEKFVRSVHGFQMLYAD 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D2hgdhNP_569982.1 GlcD 85..532 CDD:223354 79/410 (19%)
FAD_binding_4 115..252 CDD:279851 22/101 (22%)
FAD-oxidase_C 291..531 CDD:280983 49/266 (18%)
DHCR24NP_055577.1 GlcD 114..>263 CDD:223354 33/170 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.