DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-p and L3MBTL4

DIOPT Version :9

Sequence 1:NP_476871.2 Gene:ph-p / 31181 FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:XP_011524059.1 Gene:L3MBTL4 / 91133 HGNCID:26677 Length:651 Species:Homo sapiens


Alignment Length:79 Identity:20/79 - (25%)
Similarity:39/79 - (49%) Gaps:18/79 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1462 AAISAPSPLAMPLGSPLSV-ALPTLAPLSVVTSGAAPKSSEVNGTDRPPISSWSVDDVSNFIREL 1525
            :.:||.....:|||..... .||.:|.:         ::|:|        :.|:||:|:.|::.|
Human   508 STVSAHPFRDLPLGREQHCKLLPGVADI---------RASQV--------ARWTVDEVAEFVQSL 555

  Fly  1526 PGCQDYVDDFIQQE 1539
            .||:::...|.::|
Human   556 LGCEEHAKCFKKEE 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 10/32 (31%)
SAM 1511..1576 CDD:197735 10/29 (34%)
L3MBTL4XP_011524059.1 MBT 57..149 CDD:214723
MBT 164..260 CDD:214723
MBT 273..364 CDD:214723
zf-C2HC 379..405 CDD:279824
SAM_superfamily 540..>569 CDD:301707 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.