DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-p and Samd7

DIOPT Version :9

Sequence 1:NP_476871.2 Gene:ph-p / 31181 FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:NP_083765.2 Gene:Samd7 / 75953 MGIID:1923203 Length:445 Species:Mus musculus


Alignment Length:412 Identity:91/412 - (22%)
Similarity:141/412 - (34%) Gaps:130/412 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1279 TSTTTTTTSSISNGSKDLPKA-------MIKPNVLTHVI----------------DGFIIQEANE 1320
            |:...:.:|.:::|.:.:|..       ::..:||:..|                .|  :..||.
Mouse     2 TNPMMSVSSLLTSGQQKVPMVPSPFGPPIVDRDVLSSSIAPTDPSQFCVPSQFGSSG--LPNANM 64

  Fly  1321 PFPVTRQRYADKDVSDEPPKKKATMQEDIKLSGIASAPGSDMVACEQCGKMEHKAKLKRKRYCSP 1385
            |.|::...|:...:....|.|..|.:.::.....|:....:|.:..|..:||             
Mouse    65 PNPLSSHFYSGWGILPPEPIKAVTTRNEMFERHHAARAEMEMYSLYQQRRME------------- 116

  Fly  1386 GCSRQAKNGIGGVG----------SGETNGLGTGGIVGVDA----------------MALVDRLD 1424
               |....|:.|:|          .|.|...|...:...|.                :|......
Mouse   117 ---RVNPKGLSGLGIPLFYGSSCLGGPTGFQGRSTLPASDVHLHRSTFRHLQGNPILLATRPHFT 178

  Fly  1425 EAMAE------------------EKMQTEATPKLSESFPILGASTEV----PPMSLPVQ--AAIS 1465
            |...:                  |..:::|..|.|...|.|....|.    |.:.:..|  ..::
Mouse   179 ECWGQKYRLRRGAVYQKPPESDTESFKSQAEEKSSSQMPTLSYEEEEYIKDPDIEVDNQQKPRVA 243

  Fly  1466 APSPLAMPLGSPLSVALPTLAPLSVVTS----GAAPKSSEV-------NGTDRP----PIS---- 1511
            ...|..:|......:......|.|:..:    |....|.:|       ||..||    |:|    
Mouse   244 DGKPTTVPANPHGELHTHQRKPSSLEANAWDDGKGKPSEQVYEGCDGKNGVFRPVSILPLSGTHE 308

  Fly  1512 --------------SWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLG 1562
                          .|:||||.||||.||||.||...|....|||:.|.||.|:||...||:|||
Mouse   309 QVALRENCSLSDIQKWTVDDVYNFIRSLPGCSDYAQVFKDHAIDGETLPLLTEQHLRGTMGLKLG 373

  Fly  1563 PALKIVAKVES------IKEVP 1578
            |||||.::|..      .|::|
Mouse   374 PALKIQSQVSQHVGNMFCKKLP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976 39/95 (41%)
SAM 1511..1576 CDD:197735 37/88 (42%)
Samd7NP_083765.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..282 14/88 (16%)
SAM_Samd7,11 321..388 CDD:188978 36/66 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..445
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.