DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-p and l3mbtl3

DIOPT Version :9

Sequence 1:NP_476871.2 Gene:ph-p / 31181 FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:NP_001232893.1 Gene:l3mbtl3 / 403075 ZFINID:ZDB-GENE-040724-127 Length:523 Species:Danio rerio


Alignment Length:99 Identity:18/99 - (18%)
Similarity:42/99 - (42%) Gaps:16/99 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   744 NKMVVMSTTGTPITLQNGQTLHAATAAGVDKQQQQLQLFQKQQILQQQQML-QQQIAAIQMQQQQ 807
            |:..|:......:..:.|:..||.|...|...|:.|   .:..:|:|.... |:.:..::..::.
Zfish    38 NEFGVLEVITEEMEEERGKKAHATTTWSVPTAQEAL---SEGSVLKQDSPWGQRGLVCVRCNRKG 99

  Fly   808 AAVQ------------AQQQQQQQVSQQQQVNAQ 829
            :||.            .||:|::..::..::|.:
Zfish   100 SAVDFLPDGLHCSERCLQQEQEELKTEGSRMNGE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 SAM_Ph1,2,3 1508..1576 CDD:188976
SAM 1511..1576 CDD:197735
l3mbtl3NP_001232893.1 MBT 206..302 CDD:214723
MBT 313..409 CDD:214723
MBT 421..513 CDD:214723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.