DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-p and SAMD13

DIOPT Version :10

Sequence 1:NP_476871.2 Gene:ph-p / 31181 FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster
Sequence 2:XP_016855866.1 Gene:SAMD13 / 148418 HGNCID:24582 Length:122 Species:Homo sapiens


Alignment Length:100 Identity:38/100 - (38%)
Similarity:57/100 - (56%) Gaps:12/100 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1469 PLAMPLGSPLSVALPTLAPLSVVTSGAAPKSSEVNGTDRPP-ISSWSVDDVSNFIRELPGCQDYV 1532
            |.::|:   |||.:......||     ..|:|..||  ||| .:.|:|.||.|:.|.: |.::..
Human    16 PCSLPM---LSVDMENKENGSV-----GVKNSMENG--RPPDPADWAVMDVVNYFRTV-GFEEQA 69

  Fly  1533 DDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKI 1567
            ..|.:|||||::|||:....::..:.:||||||||
Human    70 SAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKI 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-pNP_476871.2 DUF5585 1015..>1232 CDD:465521
SAM_Ph1,2,3 1508..1576 CDD:188976 25/60 (42%)
SAMD13XP_016855866.1 SAM_Atherin-like 48..116 CDD:188982 23/57 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.