DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-76 and FEZ2

DIOPT Version :9

Sequence 1:NP_001259172.1 Gene:Unc-76 / 31179 FlyBaseID:FBgn0040395 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001036013.1 Gene:FEZ2 / 9637 HGNCID:3660 Length:380 Species:Homo sapiens


Alignment Length:437 Identity:140/437 - (32%)
Similarity:210/437 - (48%) Gaps:133/437 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NCNTLQGGSLIEIGLSDVGLVPGEGAGVGLDGLEKRSLAVGDHVDNFTETFGGSLEDLVNTFDEK 154
            |||          ...:.|...|..||.|.||....:.::                      :||
Human    25 NCN----------ASPEPGAEAGAEAGGGADGFPAPACSL----------------------EEK 57

  Fly   155 ITKCFGNYEENVE----ELAPVQVRSQEEIMNECQMWWTITGNFGNILPIDWSKSYTRQMHMPTL 215
            ::.||...:...|    .:.|:..||   ::...::|..:|.|:||::|:||..|:||.:|:.||
Human    58 LSLCFRPSDPGAEPPRTAVRPITERS---LLQGDEIWNALTDNYGNVMPVDWKSSHTRTLHLLTL 119

  Fly   216 NLGQNHTKQQQQNRNQQQQLHNQSHQAYPHTNGLGSGSGSGLDAQTPGDEFNDLTSEDEAVANDL 280
            ||                                   |..|:......|     ||:||.:...|
Human   120 NL-----------------------------------SEKGVSDSLLFD-----TSDDEELREQL 144

  Fly   281 DMHALILNGLNGDMDDQPIKTVEEVIKEIDDIMDEAESPLDE--PETCD------SEVIEKAREV 337
            |||::|::.:|    |:|:.|.::||:||:::|.|:..|.|:  |...|      .|:....|..
Human   145 DMHSIIVSCVN----DEPLFTADQVIEEIEEMMQESPDPEDDETPTQSDRLSMLSQEIQTLKRSS 205

  Fly   338 LGAPLYAEKLQYLTTTQLNELYMEMEVLIQELSETLINELALRDELEFEKELKNSFISLLLAVQN 402
            .|:  |.|:::.|:.::|||:..|:|..|:|.||.|:.:||||||||||||:||||||:|:.|||
Human   206 TGS--YEERVKRLSVSELNEILEEIETAIKEYSEELVQQLALRDELEFEKEVKNSFISVLIEVQN 268

  Fly   403 KRRQY-HVEKKRGKFQ---------------------------------------GPEPKYLTTV 427
            |:::: ...||:.|.:                                       |.|.:|||||
Human   269 KQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTRFSMEGISNVIQNGLRHTFGNSGGEKQYLTTV 333

  Fly   428 IPYHLENGTPNNQSLQVLIKILKAINEDSPTVPALLTDYILKVLCPT 474
            |||..:||.|:.:.||:|.|||:|:.|||..||:|||||||||||||
Human   334 IPYEKKNGPPSVEDLQILTKILRAMKEDSEKVPSLLTDYILKVLCPT 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-76NP_001259172.1 FEZ 143..418 CDD:285060 92/326 (28%)
FEZ2NP_001036013.1 FEZ 51..270 CDD:285060 88/289 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142918
Domainoid 1 1.000 143 1.000 Domainoid score I4663
eggNOG 1 0.900 - - E1_KOG3919
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3742
Inparanoid 1 1.050 205 1.000 Inparanoid score I3726
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46356
OrthoDB 1 1.010 - - D1186463at2759
OrthoFinder 1 1.000 - - FOG0002964
OrthoInspector 1 1.000 - - otm40562
orthoMCL 1 0.900 - - OOG6_106736
Panther 1 1.100 - - LDO PTHR12394
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1959
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.