DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-76 and Fez1

DIOPT Version :9

Sequence 1:NP_001259172.1 Gene:Unc-76 / 31179 FlyBaseID:FBgn0040395 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001344539.1 Gene:Fez1 / 235180 MGIID:2670976 Length:392 Species:Mus musculus


Alignment Length:415 Identity:128/415 - (30%)
Similarity:196/415 - (47%) Gaps:122/415 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LEKRSLAVGDHVDNFTETFGG--SLEDLVNTFDEKITKCFGNYEENVEELAPV----QVRSQEEI 180
            ||..||:   .::||:.....  |:|||||.||||:..||.||....|.||||    |::.:||.
Mouse    38 LEDPSLS---ELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNAKTESLAPVKNQLQIQEEEET 99

  Fly   181 MNECQMWWTITGNFGNILPIDWSKSYTRQMHMPTLNLGQNHTKQQQQNRNQQQQLHNQSHQAYPH 245
            :.:.::|..:|.|:...|..||     |..::..||           ..:...::|.:..     
Mouse   100 LRDEEVWDALTDNYIPSLSEDW-----RDPNIEALN-----------GNSSDIEIHEKEE----- 143

  Fly   246 TNGLGSGSGSGLDAQTPGDEFNDLTSEDEAVANDLDMHALILNGLNGDMDDQPIKTVEEVIKEID 310
                              :|||:.:..|              :|:|    ::|:.|.::||:||:
Mouse   144 ------------------EEFNEKSEND--------------SGIN----EEPLLTADQVIEEIE 172

  Fly   311 DIMDEAESPLDEPETCD----SEVIEKAREVLGAPLYA-----------EKLQYLTTTQLNELYM 360
            ::|..:..|.:|.|..:    .|:..:|..||...:.|           |.|::::.::|.||..
Mouse   173 EMMQNSPDPEEEEEVLEEEDGGEISSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLD 237

  Fly   361 EMEVLIQELSETLINELALRDELEFEKELKNSFISLLLAVQNKRR-QYHVEKKRGK--------- 415
            .:|..|::.||.|:::||.|||||||||:|||||::|:.||||:| |..:.|||.|         
Mouse   238 RVEGAIRDFSEELVHQLARRDELEFEKEVKNSFITVLIEVQNKQREQRELMKKRRKEKGLSLQSN 302

  Fly   416 -------------------------------FQGPEPKYLTTVIPYHLENGTPNNQSLQVLIKIL 449
                                           ..|.:.:||.|||||..::..|:.:.||:|..||
Mouse   303 RIEKGSQMPLKRFSMEGISNILQSGIRQTFGSSGADRQYLNTVIPYEKKSSPPSVEDLQMLTNIL 367

  Fly   450 KAINEDSPTVPALLTDYILKVLCPT 474
            .|:.||:..||.|||||||||||||
Mouse   368 FAMKEDNEKVPTLLTDYILKVLCPT 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-76NP_001259172.1 FEZ 143..418 CDD:285060 90/334 (27%)
Fez1NP_001344539.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
FEZ 58..297 CDD:369503 90/295 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..196 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833040
Domainoid 1 1.000 143 1.000 Domainoid score I4635
eggNOG 1 0.900 - - E1_KOG3919
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 204 1.000 Inparanoid score I3735
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46356
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002964
OrthoInspector 1 1.000 - - otm42633
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12394
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3073
SonicParanoid 1 1.000 - - X1959
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.890

Return to query results.
Submit another query.